KEGG   Methylocella silvestris: Msil_2505Help
Entry
Msil_2505         CDS       T00802                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msl  Methylocella silvestris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_2505
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msil_2505
  Amino acid metabolism
   00310 Lysine degradation
    Msil_2505
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Msil_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2738612..2739898
Genome map
AA seq 428 aa AA seqDB search
MTIEIRVPTLGESVSEATIGRWFKKAGDAVKADEPLLELETDKVTLEVNAPSAGVLAEII
VKDGDTVSVGALLGQIADSGAAPAKAEAPKADAKAEAPKAEAKPEAAKADAKAPAVKPGP
DGSLPIMPPSPAAAKIAADKGLDVGAIEGSGVRGQVLKGDVLAKSASPAPAPVAAPAAAT
PPAPAQARAPSPAADADREQRVRMTRLRQTIARRLKDAQNTAAMLTTFNEVDMTEVMALR
SKYKDVFEKKHGSKLGFMGFFVKACVGALKEIPSINAEIDGDDLVFKNYYHIGIAVGSEK
GLVVPVVRDADGLGLAEIEKSIAAYGKKARDGQLKIEEMQGGTFTITNGGIYGSLMSTPI
LNAPQSGILGMHKIQERPMAVGGKIEIRPMMYLALSYDHRVVDGKEAVTFLVRVKEALED
PARLVLEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaaatccgagttccgaccttgggagaatccgtcagcgaggcgaccatcggg
cgctggttcaagaaggcgggcgacgcggtcaaggccgatgagccgctgctcgaactcgaa
accgacaaggtgacgctcgaggtcaacgccccctccgcaggcgtgcttgccgaaatcatc
gtcaaggacggcgacacggtctccgtcggcgctttgctcgggcagatcgccgactctggc
gccgcgccggccaaggcggaggcgcccaaggctgacgcaaaggccgaagcgcccaaagcc
gaggccaaacctgaagcggccaaggccgacgcaaaggcgcccgcggtcaagccaggtccg
gacggcagcctgccgatcatgccgccttcgccggccgcggcgaaaatcgcggccgacaag
ggcctcgatgtcggcgctatcgagggctccggcgtgcgcggccaggtcctgaagggcgac
gtgctggccaaaagcgcgagccccgcgccagcgcccgtcgctgcccccgcggcggccacg
ccccccgcgcccgcacaggcgcgagccccatcgcccgccgccgacgccgatcgcgaacag
cgcgtgcgcatgacgcgcctgcgccagaccatcgcgcgccgcctcaaggacgcccagaac
accgcggcgatgctgacgaccttcaatgaggtcgacatgaccgaggtcatggcgctgcgc
tcgaaatataaggatgtgttcgagaagaagcacggctcgaagctcggcttcatgggattc
ttcgtgaaggcctgcgtcggcgcgctgaaggaaatcccctcgatcaacgccgagatcgat
ggcgacgacctcgtcttcaagaattactaccacatcggcatcgccgtcggctcggagaag
ggcctcgtcgtgccagtggtgcgcgacgccgacgggctcggcctcgccgagatcgaaaaa
tcgatcgccgcctatggcaagaaggcgcgcgacggccagctcaagatcgaggagatgcag
ggcggcaccttcaccatcaccaatggcggcatctatggctcgctgatgtcgacgccgatc
ctcaacgcgccgcaatcgggcattcttggcatgcacaagatccaggagcgtccgatggcc
gtcggcggcaagatcgagatccggccgatgatgtatctcgcgctctcctatgatcaccgc
gtcgtcgacggcaaggaagccgtgaccttcctcgtgcgcgtcaaggaagcgctggaggat
ccggcccggctggtgctcgaaatttag

DBGET integrated database retrieval system