KEGG   Methylocella silvestris: Msil_2640Help
Entry
Msil_2640         CDS       T00802                                 

Definition
dihydrofolate reductase
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
msl  Methylocella silvestris
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Msil_2640
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     Msil_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2887683..2888078
Genome map
AA seq 131 aa AA seqDB search
MADVRVICAIGRRGQLGLDGRLPWEGNPGREYKADVARFFDLTRGHVLIAGPRTIASFPD
WARPERTLVAVRSSDEPEEVIGRFPGRVIFIGGGPPVWSAYARFVMHWDVTKLPYDGEAD
RYLDPAWLTAG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtccgcgtgatttgcgcgatcggacggcggggacagcttgggctcgacggg
cgcctgccttgggagggcaatcccggccgcgaatataaggccgacgtcgcgcgcttcttc
gatctgacgcgcggccatgtgctgatcgcgggaccccgcaccatcgcctcttttcccgac
tgggcgcggccggagcggacgctcgtggccgtgcgttcaagtgacgaacccgaagaggtg
attggccgttttccgggccgcgtcatattcatcggcggcggacctccggtgtggagcgcc
tatgcccgcttcgtcatgcattgggacgtgacgaagctcccctatgacggcgaagccgac
cgctatctcgatccggcctggctcaccgccgggtga

DBGET integrated database retrieval system