KEGG   Methylocella silvestris: Msil_2810Help
Entry
Msil_2810         CDS       T00802                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
msl  Methylocella silvestris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_2810
   00030 Pentose phosphate pathway
    Msil_2810
   00051 Fructose and mannose metabolism
    Msil_2810
   00052 Galactose metabolism
    Msil_2810
   00500 Starch and sucrose metabolism
    Msil_2810
   00520 Amino sugar and nucleotide sugar metabolism
    Msil_2810
  Nucleotide metabolism
   00230 Purine metabolism
    Msil_2810
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msil_2810
Enzymes [BR:msl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msil_2810
    5.4.2.8  phosphomannomutase
     Msil_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3087819..3089318)
Genome map
AA seq 499 aa AA seqDB search
MFPKPAPQLFPNTLAYETTPMVKPTGFREYDARWLFEKEINLMGVQALGLGLGTLLREMG
VKPELVTGHDFRSYSSSIKLAMITGLMAAGVKVHDIGLALSPMAYFAQFELDVPAVAMVT
ASHNDNGWTGVKMGAQRPVTFGPDEMGRLKDIVLAGAYSYADGGSYRFVADFPARYAADL
TNRPKLKRKLKVVAACGNGTAGAFAPAILEQLGCEVIPLDVELDFNFPRYNPNPEDLEML
HAMAAKVLETGADVGLGFDGDGDRCGVVDDKGAEIFADKIGVMLARDLSKLHPGATFVVD
VKSTGLFATDPDLLSRGVKADYWKTGHSYIKRRVSDLGALAGFEKSGHFFFNAPVGRGYD
DGILTAIHVLDMLDRNPGKSMSELYGALPKTWGSPTMSPHCDDETKYGVVEKTLARLSAL
EAEGAKLTGQKIKSLVTVNGVRVTVEDGTWGLVRASSNKPELVVVVESPVSEARMREMFH
AVDAILRENPEVGAYNQTI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaaagccagcgccgcagctctttcccaacacgctcgcctatgagacgacgccg
atggtgaagccgaccggctttcgcgaatatgacgcgcgctggctgttcgagaaggaaatc
aatctgatgggggtccaggcgctgggcctcgggcttgggacgctgctgcgcgagatgggc
gtcaagccggagctcgtcaccggccacgacttccgctcctactcgtcttcgataaaactc
gccatgatcacggggctgatggcggccggcgtgaaagtgcatgacatcggcctcgctctg
tcgccgatggcctatttcgcgcagttcgaacttgacgttcccgccgtcgccatggtcacg
gcgtcgcataatgacaatggctggaccggcgtgaagatgggcgcgcagcggccggtgacc
ttcgggccggacgaaatgggccggctgaaggacatcgtgctcgccggcgcctatagctat
gccgatggcggctcctatcgcttcgtcgcggattttccggcccgctacgccgccgatctg
acaaaccggccgaaactcaagcgcaagctgaaagtcgtcgccgcctgcggcaatggcacg
gcgggcgccttcgccccggcgattctcgaacagctcggctgcgaggtgattccgctcgac
gtcgagctcgacttcaatttcccgcgctacaatccaaatcccgaagaccttgaaatgctg
cacgctatggcggccaaagtgctggagacgggcgccgacgtcggccttggctttgacggc
gacggcgatcgttgcggcgtcgtcgatgacaagggcgcggaaattttcgccgacaagatc
ggcgtgatgctcgcgcgcgacctctcaaagctgcatcccggcgcgacatttgtcgtcgac
gtcaaatcgaccggcctgttcgccaccgaccccgacctcctcagccgcggcgtcaaggcg
gattattggaaaaccggccattcctacatcaagcggcgcgtgagcgaccttggcgcgctc
gcgggttttgaaaaatccggtcatttcttcttcaacgcgccggtcgggcgcggatacgac
gatggaattttgaccgcgatccatgtccttgacatgctcgaccgcaaccccggcaagtcc
atgtcggagctctacggggcgctgccgaaaacctggggctcgccgaccatgtcgccgcat
tgcgacgacgagaccaaatatggcgtcgtcgaaaagacgctggcccggctttccgccctt
gaggccgaaggcgcgaagctgacgggccagaaaatcaagagcctcgtcaccgtcaacggc
gtccgggtcaccgtcgaggacggcacctggggcctcgtgcgcgcctcctccaacaagccc
gaactcgtcgtcgtcgtcgaaagccccgtctcggaagcgcgcatgcgcgaaatgttccac
gcggtcgatgccatcttgcgggagaaccccgaagtcggcgcctataatcagacgatctga

DBGET integrated database retrieval system