KEGG   Methylocella silvestris: Msil_3239Help
Entry
Msil_3239         CDS       T00802                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
msl  Methylocella silvestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3553351..3554349
Genome map
AA seq 332 aa AA seqDB search
MTADTVLVTGASGFVGSAVARALTHSGYSVRALLRPTATRENLYGLDAEIVEGDMCEMRS
VEKAMAGARFLFHVAADYRLWARDPGEIVRTNRDGTRVLMQAALREGVERIVYTSSVATI
ACRDNGAPADESSSLAECNAVGAYKRSKVLAEQIVKDMIVRDQLPAIIVHPSTPVGPRDV
RPTPTGRIILEAAMGRMPGYVDTGLNLVHVDDVASGHVAALRRGKIGERYILGGQDVPLA
GMLRDIAELCGRHPPWLRLPRALVYPFALAAEAAAHLTHKEPFVTIDGLRMSRHTMFFSS
AKAERCLGYVARPYREALNDALNWFTENGRLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcggacacggttctggtcacaggagcttcgggcttcgtcggatcggcggtcgcg
cgcgcgttgacgcattcgggctatagcgtcagggcgctgctgcggccgacggcgacgcgt
gagaatctgtacgggctcgatgccgaaatcgtcgaaggcgacatgtgcgaaatgcgctcg
gtcgaaaaggcgatggccggcgcgcgctttctttttcatgtcgcggccgactatcgtctc
tgggcgcgcgatcccggcgaaatcgtgcgcaccaaccgcgacggcacgcgcgttctgatg
caggcggctctgcgcgaaggcgtcgaacggatcgtctatacgagcagcgtggcgacgatc
gcctgccgggacaatggcgcgcccgcggatgaatccagctcgctcgccgaatgcaacgcc
gtcggcgcctataagcgcagcaaggtgctggcggagcagatcgtcaaagacatgatcgtg
cgggatcaactgccggcgatcatcgtccatccctcgacgccggtcggcccccgcgacgtc
aggccgacgccgaccgggcgcatcattctcgaggcggcgatgggccgcatgccgggctat
gtcgacaccggcctcaatctcgtccatgtcgacgacgtggcttcgggtcatgtcgcagcg
ctgcgccgcggcaagatcggcgaacgctatattctgggcgggcaggacgtgccgctcgcc
ggcatgttgagggatattgccgagctttgcgggcgccatccgccgtggctgcggctgccg
cgcgcgctcgtctatcccttcgcccttgccgccgaggcggcggcgcatctcacccacaaa
gaacccttcgtgacgatcgacggtctgcgcatgtcgcgccacaccatgttcttcagctcg
gccaaggccgagcgttgccttggctatgtggcgcggccctatcgcgaagcgctgaacgac
gccctgaactggttcaccgaaaacggacggctgaaatga

DBGET integrated database retrieval system