KEGG   Methylocella silvestris: Msil_3564Help
Entry
Msil_3564         CDS       T00802                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
msl  Methylocella silvestris
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_3564
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msil_3564
   00650 Butanoate metabolism
    Msil_3564
  Energy metabolism
   00190 Oxidative phosphorylation
    Msil_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3924921..3925310)
Genome map
AA seq 129 aa AA seqDB search
MAHDKSSSRSPVRKGFLGSAKSGASDAWSMHVTSVALLPLAIGFVWVMLSLMHKDYAGVK
AELGHPLPAIVLLLFILAGCWHMKLGMQSIIDDYIHAPHAKEWALVGNFCFSAAIALASV
FAVVKLGLS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgacaaatcatcttcccgcagccccgtgcgaaagggctttctcggctcggcc
aagtcgggcgcgagcgacgcctggagcatgcatgtcacttccgtcgcgctgctgccgctg
gccatcggcttcgtctgggtcatgctttcgctgatgcataaagactatgccggcgtgaaa
gccgaacttggccatccgctgccggcgattgtgctgcttctcttcatcctcgccggatgc
tggcatatgaagctcggcatgcagtcgatcatcgatgattacattcacgccccgcacgcc
aaggaatgggcgctcgtcggcaatttctgtttcagcgcggcgatcgccctcgcctccgtt
ttcgcggtcgtcaagctcgggctgagctga

DBGET integrated database retrieval system