KEGG   Methylocella silvestris: Msil_3697Help
Entry
Msil_3697         CDS       T00802                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msl  Methylocella silvestris
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Msil_3697
   00052 Galactose metabolism
    Msil_3697
   00500 Starch and sucrose metabolism
    Msil_3697
   00520 Amino sugar and nucleotide sugar metabolism
    Msil_3697
Enzymes [BR:msl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Msil_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4058282..4059169
Genome map
AA seq 295 aa AA seqDB search
MTKRIRKAVFPVAGLGTRFLPATKSIPKEMLTIVDRPVLQHVVEEAAEAGIEHFIFVTGR
GKAVIEDHFDIAYELDDTLQKRGKLKEFNALKEQLPAAGATSFTRQQAPLGLGHAIWCAR
ELVGDEPFAVLLPDMVTMAGPQSSGRCLSQCIEAYAKHGGNIIAVEEVAPEETHQYGIVS
IGRDFGSSFEITGMVEKPPQGTAPSNCIISGRYLLGPEIFKILEKVEKGAGGEIQLTDGM
KELAATQSFHGVRFDGKTYDCGSKLGFLSANVAFALSNPDIAGAFKAELKKFGPF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacggattcgcaaggctgtttttccggtcgcgggcctcggcacgcggtttctt
ccggcgaccaaatcgatcccgaaggaaatgttgacgatcgtcgatcgtcccgtgcttcag
catgtcgtcgaggaggcggccgaggccggcatcgagcatttcatcttcgtcaccggacgc
ggcaaggcggtcatcgaagatcatttcgacatcgcctatgagcttgacgacacgctgcag
aaacgcggcaagctgaaagagttcaacgccctcaaggagcaattgccagccgccggcgcg
acgagctttacgcgccagcaggcgccgctcggccttggccatgcgatctggtgcgcgcgg
gagctcgtcggcgacgagcctttcgccgtgctgctgcccgacatggtgacgatggccggc
ccgcagagttcaggccgctgcctctcccaatgcattgaagcctatgcaaagcacggcggc
aacatcatcgccgtcgaggaagtcgcgccggaagagacgcaccaatatggaatcgtatcg
atcggcagggatttcggctcatctttcgagattaccggcatggtggagaagccgccgcag
ggaaccgcgccgtcgaactgcatcatttccggccgctatctgctcggcccggaaatcttc
aagattctggaaaaggtcgagaagggcgcaggcggcgagatccagctgaccgacggcatg
aaggagctcgccgcgacgcagagctttcacggcgtgcgcttcgacggcaagacctatgat
tgcggctcgaagctcggctttctttcggccaatgtcgccttcgcgctgtccaatcccgat
atcgccggagccttcaaggccgaattgaagaaattcgggcctttctag

DBGET integrated database retrieval system