KEGG   Methylocella silvestris: Msil_3739Help
Entry
Msil_3739         CDS       T00802                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
msl  Methylocella silvestris
Pathway
msl00790  Folate biosynthesis
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Msil_3739
Enzymes [BR:msl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Msil_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ACK52621
JGI: Msil3739
UniProt: B8EJC9
Position
complement(4098605..4099177)
Genome map
AA seq 190 aa AA seqDB search
MAKPTEADAEAAVRVLIEWAGDDPDREGLLDTPRRVARSYRELFSGYVADPRAYLERTFE
EVGGYDELVVLRDIRVVSFCEHHMLPVLGRAHVGYLPTNKVVGISKLARVVHGFARRLQI
QEKLTAEIADAIQDILEPQGVGVVIEAEHSCMSLRGVNTIGATLITSRLLGVIRDDPRTR
EEFLRLTRGT
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaccgaccgaggccgacgccgaagccgccgtgagagtgctcatcgaatgggcc
ggcgacgatcccgatcgggaggggctgctcgacaccccgcggcgggtcgcgcgctcctat
cgggaactgttctccggctatgtcgccgatccgcgcgcctatctcgaacggacgttcgag
gaggtcggcggttatgacgaactggtcgtcttgcgcgacatccgcgtcgtcagcttctgc
gagcatcacatgctgccggtgctcggccgcgcccatgtcggctatctgccgaccaacaag
gtcgtcggcatctccaagctggcgcgcgtcgttcatggcttcgcgcgccgcctgcagatt
caggaaaaactcactgccgagatcgccgacgccattcaggatattctggagccgcagggc
gtcggcgtcgtcatcgaggccgaacatagctgcatgtcgctgcgcggggtcaatacgatc
ggcgcgacgctgatcaccagccgcctgctcggcgtcatccgcgacgatccccgcacccgc
gaagaatttctgcggctgacgcgggggacataa

DBGET integrated database retrieval system