KEGG   Methylocella silvestris: Msil_3848Help
Entry
Msil_3848         CDS       T00802                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
msl  Methylocella silvestris
Pathway
msl00240  Pyrimidine metabolism
msl00250  Alanine, aspartate and glutamate metabolism
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Msil_3848
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msil_3848
Enzymes [BR:msl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Msil_3848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACK52730
JGI: Msil3848
UniProt: B8EMQ1
Position
4215108..4216058
Genome map
AA seq 316 aa AA seqDB search
MSYHDRELTFPHRHLLGIEGLSPQDIDVLLDLSEHAIEVSRQVEKKLSTLRGRTLINLFF
EASTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLLDTAMTLNAMRPDIIVVRHAQAG
AVHLLARKVDCSVVNAGDGAHEHPTQALLDALTIRRNRGRIAGLIVAICGDILHSRVARS
NILLLTALGARVRVIGPSTLLPAGIARMGVEVFTDMKQGLQDADIVMMLRLQRERMQGGF
IPSPKEFFRFFGLDEEKLGYARPDALVLHPGPMNRGVEIDSAVADGGQSRIREQVEMGVA
VRIAVLGALAAHLPNE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtaccatgatcgagagttgaccttcccgcaccggcatctgctcggcatcgagggg
ctttcgccgcaggatatcgatgtgctgctcgatctttcggagcacgcgatcgaagtgtcg
cgccaggtcgagaagaagctctcgacgctgcgcggccgcactctcatcaatctgtttttc
gaagcttcgacccggacgcagtcctcttttgagctcgccggcaagcggctcggggccgac
gtcatgaatatgtcggtcgcctcgtccagcgtcaaaaagggcgagaccctgctcgacacg
gcgatgaccctcaacgccatgcggcccgacattatcgttgtgcgccacgcgcaggccggc
gcggtgcatcttctggcgcgcaaggtcgattgctccgtggtcaacgccggcgacggggcg
catgagcatccgacgcaggcgctgctcgacgcgctgacgatccggcgcaaccgcggccgc
atcgccggtctcattgtcgcgatctgcggcgacattctgcattcgcgcgtcgcccgctcg
aacatcctgctgctgacggcgctcggcgcccgcgtgcgcgtgatcggcccctcgacgctg
ctgccggccgggatcgcgcgcatgggcgtcgaagtgttcaccgacatgaagcaggggctg
caggacgccgacatcgtcatgatgctgcgcctacagcgcgagcgcatgcagggcggcttc
attccctcgccgaaagagttcttccgtttcttcggcctcgacgaggaaaagctcggctat
gcgcggccggacgccttggtgctgcatcccggcccgatgaatcgcggcgtcgaaatcgat
tcggccgtcgccgacggcggccagagccgcattcgcgagcaggtcgagatgggcgtcgcc
gtgcgcatcgcggtgctcggcgcgctcgccgcccatctgcctaacgagtga

DBGET integrated database retrieval system