KEGG   Methylocella silvestris: Msil_3878Help
Entry
Msil_3878         CDS       T00802                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
msl  Methylocella silvestris
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:msl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4255490..4256527
Genome map
AA seq 345 aa AA seqDB search
MTDRSVGDAGKDKSAADAAERGADAGLCPPGAIVTRIRTADRAALRVARWSCGDVCAGTV
VVLPGRAEFIEKYYEVAGELLARNFDVVMMDWRGQGGSSRQAGNPLKGHIGKFDAYQRDL
DALRSEILEPYGRLPFFALGHSMAGAILLEQAHAGRSFFERLALTAPMIDLPRLRYARPV
RGLTRGLCLTGLARAFAPGAGGATPYLTRPFGGNVLTSDPVRYARMAAYIAASPELAIGG
PTIGWASAAFRQMRRFEDGEYPRRILTPTLIVAAGADAVVDTPSIEAFASRLKAGRCITL
RRARHEILIERDAIRAQFWAAFDAFIPGSLKGTDPFAASLSAPLS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgaagcgtcggcgacgccggcaaggacaaaagcgccgcggacgcagctgag
cgcggcgccgacgcgggcctctgtccgccgggcgcgatcgtgacgcggatccggaccgcg
gacagggccgccctgcgcgtcgcgcgctggagctgcggcgacgtctgcgcgggcacggtc
gtcgtgctccccggccgggctgaatttatcgaaaaatattatgaggtcgcaggggagctg
ttggcgcgcaatttcgacgtcgtcatgatggactggcgggggcagggcggctcgtcgcgc
caggccggcaatccgctcaaaggccacatcggcaagttcgacgcctatcagcgcgatctc
gacgccttgcgcagcgaaatattggagccctacggccggctgccgtttttcgcgctcggc
cattccatggcgggcgcgattttgctggaacaggctcatgccggccggtcgtttttcgag
cgtctcgcgctcaccgcgccgatgatcgatctgccgaggctacgttatgcgcggcccgtc
cgcggcctcacccgcggtctttgcctgacaggtcttgcccgcgctttcgcgccgggcgcc
ggaggagcgacgccctatctgacgcggcccttcgggggaaatgtgctgacctcggatccc
gttcgctatgcgcggatggcggcctatatcgccgccagcccggagctcgccatcggcggt
ccgacgatcggctgggctagcgccgcctttcgtcagatgaggcgcttcgaggacggcgaa
tatccgcgccgcatcctgacgccgacgctaatcgtggccgcgggcgccgacgcagtcgtc
gatacgccctcgatcgaggctttcgcgagcaggctgaaggccggccgctgcatcacgctg
cgccgcgcccgccatgaaattctgatcgagcgggacgccatccgcgcgcaattctgggcg
gcgttcgacgccttcatccctggctcgctgaagggaacggaccctttcgcggcaagcctc
tcggcgcccctgagctga

DBGET integrated database retrieval system