KEGG   Methylocella silvestris: Msil_3903Help
Entry
Msil_3903         CDS       T00802                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msl  Methylocella silvestris
Brite
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Msil_3903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4280149..4281078
Genome map
AA seq 309 aa AA seqDB search
MCLALLLLTTATFAQAPGSRSSALTLPTDPELITPIPPAPVADPEKLALGKRLFEDARLS
HDATRSCASCHDVQTNGADANRRSSALNGTELSLNTNTVFNAALSFRLNWEGGFRSLEDQ
AEASLANPAIMGTSIDEVISRLSADAEMTQRFKEAYGSDPDRQAVLNAIATYERSLVTPG
GRFDLWLGGEASALSAQEAAGYNLFKKFGCISCHQGVNIGANLFERHGIFHPLASPKPEI
LRVPSLRNVATTPPYFHDGSAPTLSDAVRKMGAAQLNRTLTDEQVAAIVAFLGTLTGTFD
DHPVKASAP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttggctctattgctcctgaccacggccacgttcgcgcaagcgccaggctccaga
agctctgccttgacgttgccgacggatcccgaactgatcacgcctattccgccggcgccc
gtcgccgatccggagaagctcgcccttggcaaacgacttttcgaggatgcgcgtctatct
cacgatgcgacgcgttcttgcgcgtcctgccatgacgtccagaccaacggggcggacgcc
aatcgtcgcagctccgcgcttaatggaaccgagctatcgctcaacaccaataccgtcttc
aatgcggccctcagctttcggctcaattgggagggcggctttcgcagcctggaagaccag
gccgaggcttcgctcgcaaatccggcgatcatgggaacgagcattgacgaggtcattagc
agattgagcgccgacgccgagatgacgcaacggttcaaggaggcctatggctccgatccg
gaccggcaggcggtgctgaacgcgatcgccacctatgagcgatctctcgtcacgccgggc
ggccgtttcgacctctggctcggcggggaggcttcggcgctctccgctcaggaggcggcc
ggctataatctgttcaagaaatttggctgcatttcctgccatcaaggcgtgaatatcggc
gccaatttgttcgaaaggcacggcatctttcatccgcttgcgtcgccgaaacccgagatt
ctgcgcgtgccgagcctgcgcaatgtagcgacaacgccgccctatttccacgacggcagc
gccccgaccctcagcgacgcggttcggaagatgggcgccgctcaactgaatcgcacgctt
acagatgagcaggtcgcagcgatcgtcgcctttctcggaactttaaccgggaccttcgac
gatcaccccgtcaaggcgtcggcgccatga

DBGET integrated database retrieval system