KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0127Help
Entry
MSMEG_0127        CDS       T00434                                 

Definition
oxidoreductase, zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEG_0127
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0127
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_0127
  Amino acid metabolism
   00350 Tyrosine metabolism
    MSMEG_0127
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEG_0127
   00626 Naphthalene degradation
    MSMEG_0127
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MSMEG_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(148387..149478)
Genome map
AA seq 363 aa AA seqDB search
MKIRGAVLERIGAPRPYAESRPLTISELDLADPGPDELLVRIESAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGVVETPGADLETGQRVVMTFLPRCGSCPACGTDGLTPCGPGSVANGAG
TLMNGDIRLRRDGEPVFHHLGVSGFATHAVVDRRSIVPVPDDVPATVAALLGCAVLTGGG
AVLNVGRPKPGQTVVVVGLGGVGMAAALTALAHDDVRVVGVDQLSDKLARAAELGVHETF
TPEQAADLRAEVVIEAAGHPAALETAIGLTGPGGRTITVGLPRPDARITVSPLGFVAEGR
SLIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIALDDINAGMDELAEGRAVRQVI
DFA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcggagccgtcctcgaacgcatcggtgcaccccgtccctacgccgaatcc
cggccactgaccatctccgaactcgacctcgccgatccgggtccggatgaactgctggtg
cgcatcgagtccgccgggctgtgccactcggatctgtcggtcgtcgacggcaaccgggtg
cgtccggtgccgatgctgctggggcacgaggccgcgggtgtggtcgagacgccgggcgcg
gatctcgaaaccggtcagcgcgtggtgatgacgttcctgccgcgctgcggatcctgcccg
gcctgcgggaccgacgggctgaccccctgcgggccgggatcggtcgccaacggcgcgggc
acgctgatgaacggtgacatccggctgcgtcgcgacggcgaacctgtgttccaccacctc
ggtgtgtccgggttcgcgacgcacgccgtggtggaccgccgctcgatcgtgccggtaccc
gacgacgtgcccgcgacggtcgccgcgctgttgggttgcgcggtgctcacgggcggcggg
gccgtgctcaacgtcggccggccgaagccgggacagaccgtcgtggtcgtcggtctcggc
ggggtggggatggccgctgcgctcaccgcgctcgcgcacgacgacgtgcgggtggtcggt
gtcgaccagttgtccgacaagctggcccgcgcagccgaactcggcgtgcacgagaccttc
acccccgagcaggccgcggatctgcgggccgaggtggtgatcgaggccgcgggacatccg
gccgcgctggagaccgcgatcggtttgaccggtcctggcggacggaccatcacggtgggc
ctgccgcgccccgacgcgcggatcacggtgtcgccgttgggtttcgtcgccgaaggacgg
tctctgatcggcagttacctcggttcggcggtgccgtcgcgcgacatcccgcgtttcgtc
gagttgtggcgcgccgggcgcctgccggtggagtcgctcgtgtcgtcgaccatcgcgctc
gacgacatcaacgcgggcatggacgaactggccgagggccgtgcggtgcgtcaggtgatc
gacttcgcctga

DBGET integrated database retrieval system