KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0590Help
Entry
MSMEG_0590        CDS       T00434                                 

Gene name
rhaD
Definition
short chain dehydrogenase (EC:1.1.1.1 4.1.2.19)
Organism
msm  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666069..668123
Genome map
AA seq 684 aa AA seqDB search
MGSMSMNAEQTVAELIARSNRLGSDPKNTNYAGGNTSAKGTDTDPVTGQPVELLWVKGSG
GDLGTLTENGLAVLRLDRMRALVDVYPGVEREDEMVAAFDYCLHGRGGAAPSIDTAMHGL
VDAAHVDHLHPDSGIALATAADGEALTKQIFGDRVVWVPWRRPGFQLGLDIADIKRRNPQ
AIGTILGGHGITAWGSTSAEAEAHSLEIIETAERYIAENGRPEPFGAPLAGYGALPDDAR
RAKAAQLAPFIRGLVSTDRPQVGHFTDDPRVLEFLSASEHPRLAALGTSCPDHFLRTKVK
PLVLDLPADATVDECKNRLAELHEAYRVDYQAYYDRHATPDSPAIRGADPAIVLIPGVGM
FSYGKDKQTARVAGEFYLNAINVMRGAEAISTYAPIDEAEKFRIEYWALEEAKLQRMPKP
KPLATRIALVTGAASGIGKAIATRLAAEGACVVIADLDGAKAESAAAEIGNTDVAVGIAA
DVTDEAAVQAAVDATVLAFGGIDIVVNNAGLSLSKSLLDTTAEDWDLQHNVMARGSFLVS
KAAARALIEQKLGGDIIYISSKNSVFAGPNNIAYSATKADQAHQVRLLAAELGEHGVKVN
GINPDGVVRGSGIFAGGWGAKRAAVYGVPEEELGKYYAQRTLLKREVLPEHVANAAFALC
TSDFSHTTGLHVPVDAGVAAAFLR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtggggagcatgagcatgaacgccgaacaaacggtcgcagagctgatcgcccggtccaac
cggctgggctcggacccgaagaacaccaactacgccggcggcaacacctcggccaagggc
accgacaccgacccggtcaccgggcagcctgtcgaactgttgtgggtcaagggatccggc
ggtgatctcggaacgctcaccgagaacgggctcgcggtactgcgactggaccgcatgcgc
gcactggtggacgtgtaccccggggtcgagcgcgaagacgagatggtcgcggcgttcgac
tactgcctgcacggccgcggtggcgcggcgccgtcgatcgacaccgccatgcacggcctg
gtcgacgccgctcacgtcgaccacctgcaccccgactcgggtatcgcgctggccaccgcg
gccgacggtgaggcgctgaccaagcagatcttcggcgatcgcgtggtgtgggtgccgtgg
cggcgcccaggcttccagttgggcctcgacatcgccgacatcaagcgacgtaacccccag
gccatcggcaccatcctcggcgggcacggcatcacggcgtggggctcgacttccgcagag
gccgaggcacattcgttggagatcatcgagaccgccgaacgctacatcgccgagaacggg
cggcccgagccgttcggcgccccgcttgccgggtacggcgcgctgcccgacgacgcacga
cgcgccaaggccgcccagctcgcaccgttcatccgcggtctggtctccaccgacaggccg
caggtcggccacttcaccgacgaccctcgtgtgctcgaattcctctccgccagtgagcat
ccccgcctcgcggcgctgggcaccagctgccccgaccacttcctgcgcaccaaggtcaag
ccgctcgtgctggatctgcccgccgacgccacggtcgacgagtgcaagaaccggttggcc
gaactgcacgaggcctaccgggtggattaccaggcctactacgaccggcacgccacgccc
gacagccccgcgatccgcggagccgacccggccatcgtgctgatccccggcgtcggcatg
ttcagctacggcaaggacaagcagaccgcccgcgtggcaggcgagttctacctcaacgcc
atcaacgtcatgcgcggtgccgaggccatctccacctacgcgcccatcgacgaggccgag
aagttccgcatcgagtactgggcactcgaagaggccaaactgcagcgcatgcccaaaccc
aaaccgctggccacgcggatcgcactggtcaccggtgcggcctcgggcatcggcaaggcc
atcgcgacccgcctggccgccgaaggcgcctgcgtggtgatcgccgacctggacggcgcc
aaggcggaatccgcggcagccgagatcggtaacaccgacgtggccgtcgggatcgccgcc
gacgtcaccgacgaggccgcggtacaggccgcggtcgacgcgaccgtactggccttcggc
ggcatcgacatcgtggtgaacaatgccgggctctcgctgtcgaagtcgttgctggacacc
accgccgaggactgggacctgcagcacaacgtgatggcccgtggctcgttcctggtgtcg
aaggccgcggcacgcgcgctcatcgagcagaagctgggcggcgacatcatctacatctcg
tcgaagaactcggtgttcgccgggcccaacaacatcgcctactcggcgaccaaggccgat
caggcgcatcaggttcggctgctggcggccgaactcggcgagcacggcgtcaaggtcaac
ggcatcaaccccgatggtgtggtacgcggctcgggtatcttcgccggcggttggggcgcc
aaacgtgccgcggtgtacggggttccggaagaggagctgggcaagtactacgcgcagcgc
accctcctcaagcgtgaggtcctgcccgagcacgtcgccaacgcggcgttcgcgctgtgc
acgtcggacttctcgcacaccaccggtctgcatgtgccggtggatgcgggggtcgccgcg
gcgtttttgcgatga

DBGET integrated database retrieval system