KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0590Help
Entry
MSMEG_0590        CDS       T00434                                 

Gene name
rhaD
Definition
(RefSeq) short chain dehydrogenase
Organism
msm  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Aldolase_II KR Epimerase 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 4535126
NCBI-ProteinID: YP_885001
UniProt: A0QQ13
Position
666069..668123
Genome map
AA seq 684 aa AA seqDB search
MGSMSMNAEQTVAELIARSNRLGSDPKNTNYAGGNTSAKGTDTDPVTGQPVELLWVKGSG
GDLGTLTENGLAVLRLDRMRALVDVYPGVEREDEMVAAFDYCLHGRGGAAPSIDTAMHGL
VDAAHVDHLHPDSGIALATAADGEALTKQIFGDRVVWVPWRRPGFQLGLDIADIKRRNPQ
AIGTILGGHGITAWGSTSAEAEAHSLEIIETAERYIAENGRPEPFGAPLAGYGALPDDAR
RAKAAQLAPFIRGLVSTDRPQVGHFTDDPRVLEFLSASEHPRLAALGTSCPDHFLRTKVK
PLVLDLPADATVDECKNRLAELHEAYRVDYQAYYDRHATPDSPAIRGADPAIVLIPGVGM
FSYGKDKQTARVAGEFYLNAINVMRGAEAISTYAPIDEAEKFRIEYWALEEAKLQRMPKP
KPLATRIALVTGAASGIGKAIATRLAAEGACVVIADLDGAKAESAAAEIGNTDVAVGIAA
DVTDEAAVQAAVDATVLAFGGIDIVVNNAGLSLSKSLLDTTAEDWDLQHNVMARGSFLVS
KAAARALIEQKLGGDIIYISSKNSVFAGPNNIAYSATKADQAHQVRLLAAELGEHGVKVN
GINPDGVVRGSGIFAGGWGAKRAAVYGVPEEELGKYYAQRTLLKREVLPEHVANAAFALC
TSDFSHTTGLHVPVDAGVAAAFLR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtggggagcatgagcatgaacgccgaacaaacggtcgcagagctgatcgcccggtccaac
cggctgggctcggacccgaagaacaccaactacgccggcggcaacacctcggccaagggc
accgacaccgacccggtcaccgggcagcctgtcgaactgttgtgggtcaagggatccggc
ggtgatctcggaacgctcaccgagaacgggctcgcggtactgcgactggaccgcatgcgc
gcactggtggacgtgtaccccggggtcgagcgcgaagacgagatggtcgcggcgttcgac
tactgcctgcacggccgcggtggcgcggcgccgtcgatcgacaccgccatgcacggcctg
gtcgacgccgctcacgtcgaccacctgcaccccgactcgggtatcgcgctggccaccgcg
gccgacggtgaggcgctgaccaagcagatcttcggcgatcgcgtggtgtgggtgccgtgg
cggcgcccaggcttccagttgggcctcgacatcgccgacatcaagcgacgtaacccccag
gccatcggcaccatcctcggcgggcacggcatcacggcgtggggctcgacttccgcagag
gccgaggcacattcgttggagatcatcgagaccgccgaacgctacatcgccgagaacggg
cggcccgagccgttcggcgccccgcttgccgggtacggcgcgctgcccgacgacgcacga
cgcgccaaggccgcccagctcgcaccgttcatccgcggtctggtctccaccgacaggccg
caggtcggccacttcaccgacgaccctcgtgtgctcgaattcctctccgccagtgagcat
ccccgcctcgcggcgctgggcaccagctgccccgaccacttcctgcgcaccaaggtcaag
ccgctcgtgctggatctgcccgccgacgccacggtcgacgagtgcaagaaccggttggcc
gaactgcacgaggcctaccgggtggattaccaggcctactacgaccggcacgccacgccc
gacagccccgcgatccgcggagccgacccggccatcgtgctgatccccggcgtcggcatg
ttcagctacggcaaggacaagcagaccgcccgcgtggcaggcgagttctacctcaacgcc
atcaacgtcatgcgcggtgccgaggccatctccacctacgcgcccatcgacgaggccgag
aagttccgcatcgagtactgggcactcgaagaggccaaactgcagcgcatgcccaaaccc
aaaccgctggccacgcggatcgcactggtcaccggtgcggcctcgggcatcggcaaggcc
atcgcgacccgcctggccgccgaaggcgcctgcgtggtgatcgccgacctggacggcgcc
aaggcggaatccgcggcagccgagatcggtaacaccgacgtggccgtcgggatcgccgcc
gacgtcaccgacgaggccgcggtacaggccgcggtcgacgcgaccgtactggccttcggc
ggcatcgacatcgtggtgaacaatgccgggctctcgctgtcgaagtcgttgctggacacc
accgccgaggactgggacctgcagcacaacgtgatggcccgtggctcgttcctggtgtcg
aaggccgcggcacgcgcgctcatcgagcagaagctgggcggcgacatcatctacatctcg
tcgaagaactcggtgttcgccgggcccaacaacatcgcctactcggcgaccaaggccgat
caggcgcatcaggttcggctgctggcggccgaactcggcgagcacggcgtcaaggtcaac
ggcatcaaccccgatggtgtggtacgcggctcgggtatcttcgccggcggttggggcgcc
aaacgtgccgcggtgtacggggttccggaagaggagctgggcaagtactacgcgcagcgc
accctcctcaagcgtgaggtcctgcccgagcacgtcgccaacgcggcgttcgcgctgtgc
acgtcggacttctcgcacaccaccggtctgcatgtgccggtggatgcgggggtcgccgcg
gcgtttttgcgatga

DBGET integrated database retrieval system