KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0718Help
Entry
MSMEG_0718        CDS       T00434                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00620  Pyruvate metabolism
msm00640  Propanoate metabolism
msm00680  Methane metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0718
   00620 Pyruvate metabolism
    MSMEG_0718
   00640 Propanoate metabolism
    MSMEG_0718
  Energy metabolism
   00680 Methane metabolism
    MSMEG_0718
Enzymes [BR:msm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSMEG_0718
Lipid biosynthesis proteins [BR:msm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSMEG_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 4534254
NCBI-ProteinID: YP_885124
UniProt: A0QQD6
Position
804960..806609
Genome map
AA seq 549 aa AA seqDB search
MARDVCTVEQAWDAIESRLDRDPFGPDFNTAHEACSRYATDPGRLALTVRHEDGSADQWS
YRELDRQAAKAARVFARAGLRRGDRVAGLLTRQVESWITALAAWRSGLVYVPLFGGFGPE
PIALRIKAARVSAVVVDARYREALHRAQQLGDLDVSVFVVGGSEVACDRSFWSDLDSADA
DGPIVPTKIVDTATILFTSGTSGTPKACVMTHAAFLSVMPYAVSVLGLGPHSRDVVFSTA
DPAWAYGLYSTGASVMALGVHRVMYTGPFVPEKWYRVLTEEQATVVTTAPAALRRWTEPL
THGGVPSSLRLVAAAGEPLTEAVASAWEATGAPPVRNGYGLSEVGMLLGDVLDADVPLHP
GKIAGTIPGFDVFLADRDGQPVGEGEPGLIAVRRPRHQMSAGYENVPERWEARWREDVFL
TEDLAVRDAEGRWQVLGRDDDIIIASGHNVSPVEVENALLQHPGVAEAAAVAHVDDTYGN
VVRAVVVRTDTAPAQDVMVDELKGLVGQHVGRYAAPRVVDFVSELPRTEVGKLRRAALRD
NPVSGVSAP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgacgtatgcactgtcgagcaggcctgggacgccatcgagtcgcggctcgac
cgtgatcctttcggcccggacttcaacaccgcacacgaggcgtgcagccggtatgcgacc
gatccgggacgcctggcgctgacggtccggcatgaggacggatcggccgaccagtggagc
taccgtgagctggaccgccaggccgccaaggccgcaagggttttcgcgcgtgcgggcctg
cgccgcggcgaccgcgtggcgggactgctgacgcgtcaggtcgagagttggatcaccgcg
ttggccgcctggcgatccggtctggtgtacgtgccgttgttcggcggcttcggtcccgag
ccgatcgcgttgcgtatcaaagccgcccgagtgtcggccgtcgtcgtcgatgcgcggtac
cgcgaagcgttgcaccgcgcgcagcaactgggcgacctcgatgtgtccgtgttcgtcgtc
ggtggctccgaggtggcgtgcgaccgatccttctggtctgatctggactccgccgatgcc
gacggtcccatcgtccccaccaaaatcgttgacaccgcgacgatcctgttcaccagcgga
acgtcgggaactcccaaggcctgcgtgatgacccacgcggcgttcctgtcggtgatgccg
tatgccgtcagtgtgctcggcctcggcccacattcgcgtgatgtggtcttctcgaccgcg
gatcccgcctgggcgtatgggctgtattccaccggtgcgtcggtgatggccctgggcgtg
caccgcgtcatgtacaccgggcccttcgtgcccgagaagtggtaccgcgtgctgaccgag
gagcaggcgaccgtcgtcacgacggcgccggcggcgctgcgccgctggaccgaaccgctg
acacatggcggggtgccatcgagtctgcgcctggtggcggcggccggcgaaccactgacc
gaagccgtggcaagcgcatgggaggcgactggcgcgcctccggtgcgcaacggttacggc
ttgtcagaggtcggcatgttgctcggcgacgtgctcgatgcggacgtccccctgcacccg
ggcaagatcgccgggaccataccgggtttcgacgtgttcctcgccgaccgggacggacaa
cccgtgggcgaaggcgagccgggcctgatcgccgtacggcgaccacgccaccagatgtcg
gccggttacgagaacgtgcccgagcggtgggaggcgcgttggcgcgaagatgttttcctc
accgaggatctcgcggtccgcgacgccgaggggcggtggcaggtgctcgggcgtgacgac
gacatcatcatcgcctccggtcacaacgtcagccccgtcgaggtggagaacgccctgttg
cagcatccgggcgtcgccgaggccgcggccgtcgcccacgtcgacgacacgtacggcaac
gtggtgcgcgcggtggtggtacggaccgacaccgcgccggcgcaggacgtcatggtcgac
gaattgaagggccttgtgggacagcacgtcggccgctacgccgccccgcgggtcgtcgac
ttcgtgagcgaactgccgcgcaccgaggtgggtaagttgcgtcgtgccgcgctccgggac
aatccggtgagcggggtcagtgcaccgtga

DBGET integrated database retrieval system