KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0935Help
Entry
MSMEG_0935        CDS       T00434                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_0935
   01230 Biosynthesis of amino acids
    MSMEG_0935
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0935
  Energy metabolism
   00680 Methane metabolism
    MSMEG_0935
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_0935
Enzymes [BR:msm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MSMEG_0935
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MSMEG_0935
  Exosomal proteins of melanoma cells
   MSMEG_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1015609..1016352
Genome map
AA seq 247 aa AA seqDB search
MATLILLRHGESQWNEKNLFTGWVDVDLTDKGRAEAVRGGQLMAEQGVLPDVLYTSLLRR
AITTAHLALDAADRLWIPVHRDWRLNERHYGALQGLDKAETKEKYGEEQFMAWRRSYDTP
PPPIEKGSKYSQDADPRYADIDGGPLTECLKDVVERFVPYYESAILPDLKAGKTVLIAAH
GNSLRALVKYLDGMSDEEVVGLNIPTGIPLRYDLDENLKPVKIGGEYLDPEAAAAGAAAV
AAQGAKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctgatcctgctccgccacggtgagagccagtggaacgagaagaacctgttc
accggttgggtggacgtcgacctcactgacaagggccgggccgaggccgtccgcggcggc
caactgatggccgagcagggcgtcctgcccgacgtgctctacacgtcactgctgcgccgg
gccatcaccaccgcgcacctcgcgctcgacgccgctgaccggctgtggatcccggtgcac
cgcgactggcggctcaacgagcgccactacggcgcgctgcagggcctggacaaggccgag
accaaggagaagtacggcgaagagcagttcatggcgtggcgccgcagctacgacaccccg
ccgccgcccatcgagaagggcagcaagtacagccaggacgccgatccgcgctacgccgac
atcgacggcggcccgttgaccgaatgcctcaaagacgtcgtcgagcggttcgtgccgtac
tacgagagcgcgatcttgcccgatctgaaggcgggcaagaccgtgctgatcgccgcccac
ggcaactcgctgcgcgcgctggtgaagtacctcgacggcatgtccgacgaggaggtcgtc
ggcctcaacatcccgaccggcatcccgctgcgctacgacctcgacgagaacctcaagccc
gtcaagatcggcggtgagtacctcgatcccgaggcggccgccgccggtgcggccgccgtc
gccgcccagggcgcgaagaagtag

DBGET integrated database retrieval system