KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0935Help
Entry
MSMEG_0935        CDS       T00434                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00260  Glycine, serine and threonine metabolism
msm00680  Methane metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
msm01230  Biosynthesis of amino acids
Module
msm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
msm_M00002  Glycolysis, core module involving three-carbon compounds
msm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0935
  Energy metabolism
   00680 Methane metabolism
    MSMEG_0935
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_0935
Enzymes [BR:msm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MSMEG_0935
Membrane trafficking [BR:msm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MSMEG_0935
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MSMEG_0935
  Exosomal proteins of melanoma cells
   MSMEG_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 4537124
NCBI-ProteinID: YP_885338
UniProt: I7FXB6 A0QR00
Position
1015609..1016352
Genome map
AA seq 247 aa AA seqDB search
MATLILLRHGESQWNEKNLFTGWVDVDLTDKGRAEAVRGGQLMAEQGVLPDVLYTSLLRR
AITTAHLALDAADRLWIPVHRDWRLNERHYGALQGLDKAETKEKYGEEQFMAWRRSYDTP
PPPIEKGSKYSQDADPRYADIDGGPLTECLKDVVERFVPYYESAILPDLKAGKTVLIAAH
GNSLRALVKYLDGMSDEEVVGLNIPTGIPLRYDLDENLKPVKIGGEYLDPEAAAAGAAAV
AAQGAKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctgatcctgctccgccacggtgagagccagtggaacgagaagaacctgttc
accggttgggtggacgtcgacctcactgacaagggccgggccgaggccgtccgcggcggc
caactgatggccgagcagggcgtcctgcccgacgtgctctacacgtcactgctgcgccgg
gccatcaccaccgcgcacctcgcgctcgacgccgctgaccggctgtggatcccggtgcac
cgcgactggcggctcaacgagcgccactacggcgcgctgcagggcctggacaaggccgag
accaaggagaagtacggcgaagagcagttcatggcgtggcgccgcagctacgacaccccg
ccgccgcccatcgagaagggcagcaagtacagccaggacgccgatccgcgctacgccgac
atcgacggcggcccgttgaccgaatgcctcaaagacgtcgtcgagcggttcgtgccgtac
tacgagagcgcgatcttgcccgatctgaaggcgggcaagaccgtgctgatcgccgcccac
ggcaactcgctgcgcgcgctggtgaagtacctcgacggcatgtccgacgaggaggtcgtc
ggcctcaacatcccgaccggcatcccgctgcgctacgacctcgacgagaacctcaagccc
gtcaagatcggcggtgagtacctcgatcccgaggcggccgccgccggtgcggccgccgtc
gccgcccagggcgcgaagaagtag

DBGET integrated database retrieval system