KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0935Help
Entry
MSMEG_0935        CDS       T00434                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_0935
   01230 Biosynthesis of amino acids
    MSMEG_0935
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0935
  Energy metabolism
   00680 Methane metabolism
    MSMEG_0935
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_0935
Enzymes [BR:msm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MSMEG_0935
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MSMEG_0935
  Exosomal proteins of melanoma cells
   MSMEG_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015609..1016352
Genome map
AA seq 247 aa AA seqDB search
MATLILLRHGESQWNEKNLFTGWVDVDLTDKGRAEAVRGGQLMAEQGVLPDVLYTSLLRR
AITTAHLALDAADRLWIPVHRDWRLNERHYGALQGLDKAETKEKYGEEQFMAWRRSYDTP
PPPIEKGSKYSQDADPRYADIDGGPLTECLKDVVERFVPYYESAILPDLKAGKTVLIAAH
GNSLRALVKYLDGMSDEEVVGLNIPTGIPLRYDLDENLKPVKIGGEYLDPEAAAAGAAAV
AAQGAKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctgatcctgctccgccacggtgagagccagtggaacgagaagaacctgttc
accggttgggtggacgtcgacctcactgacaagggccgggccgaggccgtccgcggcggc
caactgatggccgagcagggcgtcctgcccgacgtgctctacacgtcactgctgcgccgg
gccatcaccaccgcgcacctcgcgctcgacgccgctgaccggctgtggatcccggtgcac
cgcgactggcggctcaacgagcgccactacggcgcgctgcagggcctggacaaggccgag
accaaggagaagtacggcgaagagcagttcatggcgtggcgccgcagctacgacaccccg
ccgccgcccatcgagaagggcagcaagtacagccaggacgccgatccgcgctacgccgac
atcgacggcggcccgttgaccgaatgcctcaaagacgtcgtcgagcggttcgtgccgtac
tacgagagcgcgatcttgcccgatctgaaggcgggcaagaccgtgctgatcgccgcccac
ggcaactcgctgcgcgcgctggtgaagtacctcgacggcatgtccgacgaggaggtcgtc
ggcctcaacatcccgaccggcatcccgctgcgctacgacctcgacgagaacctcaagccc
gtcaagatcggcggtgagtacctcgatcccgaggcggccgccgccggtgcggccgccgtc
gccgcccagggcgcgaagaagtag

DBGET integrated database retrieval system