KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0954Help
Entry
MSMEG_0954        CDS       T00434                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:msm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1031413..1033245
Genome map
AA seq 610 aa AA seqDB search
MGGADSLTKVGGADAAVAVVGAAEGSVGAAESPASDPQPRESSSRSRSRKVKPGRITFVG
SGPGDPGLLTTRAQAVLAHAELVFTDPDVPEAVLALVGTDLPPAAGPAPAKKNDKADKAT
DKSDKSDKADKADDAKSDDPAVIPGGPEVRPALGDPAEVAKTLASEARHGYNVVRLIAGD
PLSVDAVITEINALAKTHLTFEIVPGLPDTTAVPTYAGLPLGSSHTVADVRGDVDWAALA
AAPGPLILHATASHLPDAARTLIEHGLVENTPAVVTANGTTCQQRSVETTLVGLTDKTVV
EKPAGSELLGPLTGPLVVTIGKTVANRAKLNWWESRALYGWTVLVPRTKDQAGEMSERLV
THGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFNEFGLDA
RAFSGVKIACVGQATADKVRAFGINPELVPSGEQSSLGLLDEFPPYDEVFDPVNRVLLPR
ADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAHTREMIKTGGFDAVCFTSSSTVRNL
VGIAGKPHARTIVACIGPKTAETAIEFGLRVDVQPETAAVGPLVEALAEHAARLRAEGAL
PPPRKKSRRR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagccgacagtctcaccaaggtgggcggtgccgacgctgcggttgcggtggtc
ggtgcggccgagggttcggtcggtgcggccgagagcccggcgtccgaccctcagccgcgt
gagagctcgagccggtcgcgcagccgcaaggtcaagcccggtcgcatcacgttcgtcggt
tcgggccccggtgacccgggcctgctgaccaccagggcgcaggccgtgctcgcgcatgcc
gagctggtcttcaccgatcccgatgtgcccgaggcggtgctcgccctcgtcggcaccgat
ctgcccccggcggcgggtccggcgcccgccaagaagaacgacaaggccgacaaggccacc
gacaagtcggacaagtccgacaaggccgacaaggccgatgacgccaagtccgacgatccg
gcggtcatccccggcggacccgaggtgcgtcccgcgctcggcgacccggccgaggtcgcc
aagacgctcgcgtccgaggcgcgccacggatacaacgtcgtgcgcctgatcgcgggtgac
ccgctgtcggtggatgccgtgatcaccgagatcaacgcactggccaagacgcatctgacc
ttcgagatcgtcccgggtctgcccgacaccaccgcggttccgacgtacgccggcctgccg
ctggggtcgtcgcacaccgtcgccgacgtgcgtggcgacgtcgactgggccgcactggcg
gccgcgccggggccgctgatcctgcatgcgaccgcgtcgcacctgccggatgccgcccgc
acgctcatcgagcacgggctcgtcgagaacacgcccgcggtcgtcacggccaacggcacc
acctgccagcagcgttcggtcgagaccacgctggtggggctcaccgacaagaccgtggtg
gagaagcccgcgggcagcgagctgttgggcccgctgaccggaccgctggtggtcaccatc
ggcaagaccgtcgccaaccgcgccaagctgaactggtgggagagccgcgccctgtacggc
tggaccgtgctggtgccgcgcaccaaggatcaggccggcgagatgagcgagcggctcgtc
acgcacggcgccctgccgatcgaggtgcccaccatcgccgtcgagccgccgcgcagcccg
gcgcagatggagcgcgcggtcaagggcctggtcgacggccggttccagtgggtcgtgttc
acctccaccaacgccgttcgcgcggtgtgggagaagttcaacgagttcggtctggacgcc
cgcgcgttctccggcgtgaagatcgcctgcgtggggcaggccaccgcggacaaggtgcgc
gcgttcgggatcaatcccgaactggtgccgtcgggcgagcagtcctcgctcggcctgctg
gatgaattcccgccctacgacgaggttttcgacccggtcaaccgtgtgttgctgccgcgt
gcggacatcgccaccgagacgctggccgagggtctgcgtgagcgtggctgggagatcgag
gacgtcacggcgtaccgcaccgtgcgtgcggccccgccgcctgcgcacacccgcgagatg
atcaagaccggtggtttcgacgcggtgtgcttcacgtcgagttcgaccgtgcgcaacctc
gtcggcatcgcgggcaagccgcacgcccgcaccatcgtggcctgcatcggaccgaaaacc
gcagaaaccgcaatcgaattcggtctgcgcgtggatgtgcagcccgagacagccgcggtc
ggaccgctggtcgaggcgctcgccgagcacgccgcccggttgcgcgccgagggtgcgctc
ccgccgccgcgcaagaagagccgccgcaggtaa

DBGET integrated database retrieval system