KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1012Help
Entry
MSMEG_1012        CDS       T00434                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MSMEG_1012
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MSMEG_1012
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MSMEG_1012
Enzymes [BR:msm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MSMEG_1012
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEG_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1081451..1082986)
Genome map
AA seq 511 aa AA seqDB search
MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGGARRIDGDQTD
TERSAINGGKARNVILLVGDGMGDSEITMARNYEKGAGGSFDGLDALPLSGQYTTYALNK
DGKPNYVTDSAASATGWTTGTKTYNGALGIDIKGNPQKTILELAKAQGFATGDVTTSEIQ
DATSASLFSHISERDCYGPVQTAADCAADALENGGPGSVTEQLLTTRPDLTLGGGAETFS
QTANGGEYKGKTLEAQAKERGFQIVRTASELDAVTAADQDNPVIGLFADGNMPVRWSGPP
AVRHGYLQPAAKCTDNPERGSEVPRLAAMTQKAIDLLKNGKAGQDKGFYLQVEGASIDKK
DHDADPCGQIGETVDFDEAVQTALNFAREDGNTLVVVTADHGHSSQIVEALSEDDLRDIA
EDTKQPVERVRDTMYPGLTRKLVTADDAEMTVSYGTSADVDVESETHTGTQVRVAAFGPR
AANVVGLTDQTDLFFTMTDALGLDRGEEPAH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcagtacctatctcagagcgacggtggtgatcgtggcagccgcgctgctgccg
ctcacggcctgcagcagcgacaccaccacggagtccagcggtgacacggtgcaccgctcg
gccgacggcgacatcgtgaccaacggtggcgcgcgccgtatcgacggcgaccagaccgac
accgagcgcagcgcgatcaacggcggcaaggcccgcaatgtcatcctgctggtcggcgac
ggcatgggcgactcggagatcaccatggcccgcaactacgaaaagggcgcaggcggaagc
ttcgacggcctcgacgcgctgccgctgagcgggcagtacaccacctacgcgctcaacaag
gacggtaagcccaactacgtcaccgattcggccgcgagcgccacgggatggaccaccggc
accaagacctacaacggcgcgctgggcatcgacatcaagggcaacccgcagaagacgatc
ctcgaactcgccaaggcacagggtttcgcgaccggtgacgtcaccacgtcggagatccag
gacgccacctcggcgtcgctgttctcccacatcagcgagcgtgactgctacggcccggtc
cagaccgcagccgattgcgcggccgacgccctggagaacggcgggccgggttcggtgacc
gagcagttgctgaccacccgcccggacctgacattgggcggcggcgccgagacgttctcc
cagaccgcgaacggcggcgagtacaagggcaagacgctcgaagcccaggccaaggagcgt
gggttccagatcgtgcgcaccgcaagcgaactcgacgccgtcaccgcggccgatcaggac
aatccggtgatcgggctgttcgccgacggcaacatgccggtgcgctggtcaggcccgccc
gccgtgcgccacggctacctgcagcccgcggccaagtgcaccgacaatcccgagcgcggg
tccgaggtccccaggctggccgcgatgacgcagaaggccatcgatctgttgaagaacgga
aaagccggtcaggacaagggcttctacctgcaggtggaaggcgcgtcgatcgacaagaag
gaccacgacgccgacccgtgcggccagatcggcgagacggtggacttcgacgaggccgtg
cagaccgcgctcaacttcgcccgcgaggacggcaacacgctggtcgtcgtgaccgccgac
cacggtcacagcagccagatcgtggaggccctcagcgaggacgacctgcgcgacatcgcc
gaggacaccaagcagcccgtcgagcgggtccgcgacaccatgtacccgggcctgacccgc
aagctcgtcacggccgatgacgccgagatgacggtcagctacggcacttccgccgatgtc
gacgtcgagagcgagacccacaccggaacccaggtgcgtgtcgcggccttcggtccgagg
gccgcgaacgtcgtcgggctgaccgatcagaccgatctgttcttcaccatgaccgatgcg
ctcggcctcgaccgcggggaggaacccgcgcactga

DBGET integrated database retrieval system