KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1072Help
Entry
MSMEG_1072        CDS       T00434                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MSMEG_1072 (speB)
Enzymes [BR:msm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MSMEG_1072 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137579..1138550
Genome map
AA seq 323 aa AA seqDB search
MEGQPYVRSASGKVGQVNATEVPRYAGIATFARLPQRFEVLDHDIAVVGVPFDSGVTYRP
GARFGPSAIREASRLLKPYHPALDVSPFAQAQVVDAGDLGVNPFNIDEAVGQIRDGVTEL
LDRPDQRVVLLGGDHTIALPALQAMHAIHGPVALVHFDAHLDTWDTYFGAPCTHGTPFRR
ASEQGLIVKGHSAHVGIRGSLYDRADLLDDESLGFTVVHCRDIDRIGVDGVISRIHERVG
EYPVYVSIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLRAMRGLNIVGADIVEVAPAYDS
GDVTAVAAANLAYELITLMADGF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggccagccgtacgtgcggtcggcgtcgggcaaggtgggccaggtcaacgccacc
gaggtgccgcggtacgcgggcatcgcgacgttcgcgcgtctgccgcagcggttcgaggtc
ctcgaccacgacatcgcggtggtgggtgtgccgttcgacagcggtgtcacctaccggccc
ggtgcccgcttcggcccgtcggccatccgcgaggcgtcgcgtctgctcaagccgtaccac
cccgcgctcgacgtgagcccgttcgcgcaggcccaggtggtcgatgccggtgatctcggg
gtcaacccgttcaacatcgacgaggccgtcgggcagatccgtgacggcgtgaccgaactg
ctggaccgccccgaccagcgcgtggtgctgctcggcggggaccacacgatcgcgctgccc
gctctgcaggcgatgcacgccatccacggcccggtcgcgctcgtgcacttcgacgcacat
ctcgacacgtgggacacctatttcggggcgccgtgcacgcacggcacgcccttccgtcgc
gcgtcggaacaggggctcatcgtgaaaggacattcggcgcacgtcggcatccgcggatcg
ctgtacgaccgcgccgatctgctcgacgacgagtccctcggattcacggtcgtgcactgc
cgcgacatcgaccgcatcggtgtcgacggtgtcatctcgcgcatccacgagcgggtcggc
gagtatccggtgtacgtgtcgatcgacatcgacgtcctcgacccggcgttcgcgcccggc
acgggaacgcccgagatcggcggcatgaccagccgtgaactcgtcgcggtgctgcgcgcg
atgcgtggcctcaacatcgtgggcgccgacatcgtcgaggtcgcccccgcgtacgacagc
ggcgacgtcaccgcggtcgcggccgctaacctggcctacgaattgattacgctgatggcc
gatggcttctga

DBGET integrated database retrieval system