KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1325Help
Entry
MSMEG_1325        CDS       T00434                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1420424..1422088)
Genome map
AA seq 554 aa AA seqDB search
MSLLEAFAEILEPADVHVAQRLTVLADEPDASVELAVALAVRALRGGSVCVDLRSVAGQV
ELPDLPWPDPDAWLAALAASPLLGQPPVLRLFGDLLYLDRYWLEEQQVCDDVLALVSARP
GGAVPDVSRLFGAGFEEQRAAAKVALSQGLTVLTGGPGTGKTTTVARLLALLAEQAALAG
KPSPRIALAAPTGKAAARLQEAVQLEIDQLDLIERRRLTGLHATTLHRLLGPRPDTSSRF
RHHRANRLPHDVIVVDETSMVSLTMMARLLEAVRPQTRLVLVGDPDQLASVEAGAVLADL
VEGLGSRGVAELKTSHRFGESIGALASAIRTGDADAALAVLAAGGEHIEWVHEDPVEQLR
EVVVPHAMRLRQAAILGDQREALATLDEHRLLCAHRRGPAGVDHWNRQVQRWLGEETGEP
LWGSWYVGRPILVTANDYGLKLYNGDTGVVVATPDGMRAVIGDAGTFATGRLTDVETMHA
MTIHKSQGSQADEVTVLLPSEDSRLLTRELFYTAVTRAKTRVRVVGAEAEVRAAIERQAV
RATGLRKRLRPAGV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgctcgaagcgttcgccgagatcctcgaacccgccgatgtgcatgtggcgcaa
cggctgaccgtgctggccgacgaaccggacgcatcggtcgagctcgcggtcgccctcgcg
gtgcgggcgctgcgcggcggctcggtgtgtgtggacctgcggtcggtggccgggcaggtc
gaattaccggatctgccgtggccggatcccgacgcgtggctggcggcgctggcggccagt
cccctgctcggtcagccacccgtgctgcgcctgttcggcgatctgctgtatctggaccgc
tactggctcgaagagcagcaggtgtgcgacgacgtgctcgcgttggtgtcggcgcggccc
ggtggtgcggtgccggatgtgtcgagactgttcggcgcgggcttcgaggagcagcgggcg
gcggcgaaggttgcgctctcgcaagggctgacggtgttgacgggtgggccgggcaccggc
aagacgactaccgtggcacggctgttggcgttgctggccgagcaggccgcgctcgcaggc
aagccgtcgccgcgcatcgcgttggcggccccgacgggcaaggcggccgcaaggttgcag
gaggccgtgcagctcgagatcgatcagctcgacctcatcgagcgcaggcggttgaccggg
ctgcacgccaccacgctgcaccggctgctcggtccgcggcccgatacgtcgtcgcggttc
cgtcatcaccgcgccaaccggttgccgcacgacgtgatcgtcgtcgacgagacgtcgatg
gtgtcgctgaccatgatggcgcggttgttggaggccgtgcgcccgcagacacggctggtg
ctcgtcggcgatcccgatcagttggcgtcggtcgaggccggcgcggtgctggcggacctg
gtcgagggtcttggttcgcgcggtgtcgcggagctgaagacgtcgcaccggttcggtgag
tcgatcggcgcgctggcgtcggccatccgcacgggtgacgccgacgcagccctggcggtt
ctcgcggccggtggtgagcacatcgagtgggtgcacgaggatccggtcgagcagttgcgc
gaagtggtggtgccgcacgcgatgcggttgcgtcaggccgcgatcctcggtgaccagcgt
gaggcgctcgcgacgctcgacgagcaccggttgttgtgcgcgcaccgacgggggccggcc
ggcgtcgaccactggaaccggcaggtgcagcgctggctcggtgaggaaaccggtgaaccc
ctgtggggttcgtggtacgtcgggcgtccgatcctggtgaccgccaacgactatgggctc
aagctctacaacggggacaccggcgtcgtcgtcgccacaccggacgggatgcgggctgtg
atcggcgatgcgggaacgttcgcgacgggtcgcctcaccgacgtcgagaccatgcacgcc
atgacgatccacaagtcgcagggcagccaggccgacgaggtgacggtgctgctgccgtcg
gaggattcgcggttgttgacgcgggagttgttctacaccgcggtcacccgcgccaagacg
cgggtgcgcgtcgtgggcgcggaagcggaagtgcgcgctgcgatagaacggcaggcggtg
cgcgccaccggactacgcaagcggctacggccggcgggggtttag

DBGET integrated database retrieval system