KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1363Help
Entry
MSMEG_1363        CDS       T00434                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00052  Galactose metabolism
msm00500  Starch and sucrose metabolism
msm00520  Amino sugar and nucleotide sugar metabolism
msm00521  Streptomycin biosynthesis
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
Module
msm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
msm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_1363
   00052 Galactose metabolism
    MSMEG_1363
   00500 Starch and sucrose metabolism
    MSMEG_1363
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEG_1363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSMEG_1363
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MSMEG_1363
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSMEG_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-GeneID: 4536988
NCBI-ProteinID: YP_885749
UniProt: A0QS61 I7FY03
Position
1457319..1458224
Genome map
AA seq 301 aa AA seqDB search
MTLTLALDIGGTKIAAGLVDDDGALVHQAQLPTPDGDGELIWNVVDELVTGALRVADGAV
DGVGIAAAGPIDLPGGTISPINIVEWQRFPIVDRVAAATGLPVRLGGDGLCMALGEHWRG
AGRGAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHAGHVIVELEDGDLCTCGGHGCVE
TVASGPNMTRWARRQGWQAPADADAKELADAANAGDAVALAAYRRGARAVAAMIASVGAV
CDLDLVVIGGGVAKSGALLFDPIREALKNYAGLDFLRTLQVVPAELGGDAGLIGAAALAR
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaccctggccctggacatcggtggcaccaagatcgctgccggcctggtcgac
gacgacggcgctctggtgcatcaggctcagctgcccacacccgacggcgacggcgaactg
atctggaacgtcgtcgacgaacttgtcaccggggccctgcgggtggccgacggcgcggtg
gatggggtcggcatcgccgcggccgggcctatcgacctgccaggcggaaccatcagcccc
atcaacatcgtcgagtggcaacggtttccgatcgtcgatcgcgtggctgccgcgaccggg
cttccggtgcggctcggcggtgacggactgtgcatggcgctcggcgagcattggcgtggt
gcgggccggggtgcgcagttcctgctgggcatggtggtgtcgaccggcgtcgggggaggg
ctcgtgctcgacggggcgccgtacgacgggcggaccggcaacgcaggacacgcggggcac
gtcatcgtcgaactcgaagacggagacctgtgcacgtgcggtgggcacggctgcgtcgag
accgtcgcgtccggacccaacatgacgcggtgggcgcgcaggcagggttggcaggcgccg
gccgatgccgacgccaaggagctcgccgacgcggccaacgccggggatgccgtcgcgctc
gcggcgtaccggcgcggtgcacgcgcggttgcggcgatgatcgcgtcggtgggcgcggtg
tgcgatctggatctggtggtgatcggcggcggggtcgcgaagtcgggggcgctgctgttc
gacccgatccgcgaggcactgaagaactacgccggcctggatttcctgcggaccctgcag
gtggtgcctgccgaactcggcggagatgccggcctgatcggggcggcggcgctggcccgg
gcgtga

DBGET integrated database retrieval system