KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1510Help
Entry
MSMEG_1510        CDS       T00434                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:msm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:msm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1602360..1602965)
Genome map
AA seq 201 aa AA seqDB search
MTARELSIAGAWEITPVLRTDSRGLFFEWFTDAGFTEFAGHQFDMRQANCSVSARGVLRG
VHFAQVPPSQAKYVTCVRGAVFDVVVDIRVGSPTFGQWDAVLLDDKDRRSIYISEGLGHA
FLALDDDSTVMYLCSAPYAPQREHTVRPTDFGIEWPEVPELILSDRDAQAPSLAEAQAAG
VLPTWADCQAFVETLRRNLVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcgggaactgtcgatcgcgggcgcgtgggagatcacgcccgtcctgcgcacc
gattcacgggggctgttcttcgaatggttcaccgacgccggtttcaccgagttcgccggc
caccagttcgacatgcgccaggccaactgctcggtgtccgcgcgcggtgtgctccgcggc
gtgcatttcgcgcaggtgccgcccagccaggccaagtacgtgacgtgtgtgcgcggtgcg
gttttcgacgtcgtggtggacatcagggtcggctcaccgactttcggccagtgggacgcc
gtgctgctcgacgacaaggaccgccgctcgatctacatctccgagggcctggggcatgcc
ttccttgcactggacgacgattcgaccgtgatgtacctgtgctcggcgccgtacgccccg
cagcgtgagcacaccgtgcgccccaccgatttcggcatcgagtggcccgaggtgccggaa
ctgatcctgtccgaccgtgatgcccaggcaccgtcgctcgccgaggcccaggccgcaggc
gtgttgccgacgtgggcggactgccaggccttcgtagaaacgctgcggcgaaacctggtg
agctag

DBGET integrated database retrieval system