KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1604Help
Entry
MSMEG_1604        CDS       T00434                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MSMEG_1604
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MSMEG_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1690403..1692139
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDEEFAKTSWQLRKFLWAPKL
GCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADRQWAGITDWRAELTPHY
DQAQRMLGVVTNPTFTDADRVVKEVADDMGVGDTFVQTPVGVFFGPDGEKTPGKTVPDPY
FGGVGPDRTGCIECGSCMTGCRYGAKNTLLKNYLGLAERGGAEVHPLRTVAGFEQLPDGT
WRVDTVRTGRWARKDKRSFTATHVVLAAGTWGTQRLLFKMRDTGKLPKLSSRLGVLTRTN
SESIVGAGRYEVTPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGDG
PDGAGIPRWKQLLRNAAEDPRGTLRLLNVHRWSERTLIALVMQHLDNSITTYTKRNRLGI
RRYLSKQGHGAPNPTWIPVGNEVTRRIAKKIDGVAGGTWGELFNIPLTAHFLGGAAIGDS
PETGVIDPYQRVYNYPTLHVMDGAAISANLGVNPSLSITAQAERATSLWPNKGEQDQRPA
QGEPYRRLAPIAPVRPVVPADAPGALRRLPIEPVSSAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgactacgacgtcttggtgatcggttccggattcggcggcagcgtgagtgcg
ctgcggctcaccgaaaagggctaccgggtgggtgtgctcgaggcgggccgccgcttctcc
gacgaggagttcgcgaagacctcgtggcagctgcgcaaattcctgtgggcgcccaagctc
gggtgctacggcatccagcgcatccatctgctgcgcaacgtgatgatcctggccggcgcc
ggtgtcggcggcggatcgctcaactacgccaacacgctgtacgtgccgccggagccgttc
ttcgccgaccggcagtgggccggcatcaccgactggcgcgccgaactcacgccgcactac
gaccaggcgcagcgcatgctgggcgtggtcaccaacccgaccttcaccgacgccgaccgc
gtggtgaaggaggtcgccgacgacatgggcgtcggggacacgttcgtgcagacgccggtc
ggggtgttcttcggtcccgacggcgagaagacgcccggcaagaccgtgccggacccgtac
ttcggtggcgtgggcccggaccgcaccgggtgcatcgagtgcggatcgtgcatgaccggt
tgccgctacggcgccaagaacacgctgctcaagaactacctggggctcgcagaacggggc
ggtgccgaggtgcatccgctgcggacggtggccgggttcgagcaactgcccgacggcacc
tggcgcgtcgacaccgtgcgcaccggccggtgggcacgtaaggacaagcgctcgttcacc
gcgacgcacgtggtgctggccgcgggcacctggggtacgcagcggctgctgttcaagatg
cgcgacaccggcaagctgcccaagctgtcgtcacggcttggcgtgctgacgcgcaccaat
tccgaatcgatcgtcggggccgggcgctacgaggtcacgccggatctggacctcacccac
ggcgtggcgatcacgtcgtcgatccacccgacgcccgacacccacatcgaacccgtgcgc
tacggcaagggctccaacgcgatggggctgctgcagacgctgatgaccgacggcgacgga
cccgacggcgcgggaatcccgcgctggaaacagctgctgcgcaacgccgccgaggacccg
cgtggcacactgcgcctgctcaacgtgcaccgctggagcgagcgcacgctcatcgcgctg
gtcatgcagcacctggacaactcgatcaccacctacaccaaacgcaaccgcctgggcatc
cggcgctacctgagcaagcaggggcacggtgcgcccaaccccacctggatcccggtgggc
aacgaggtgacccggcggatcgccaagaagatcgacggcgtcgcgggcggcacgtgggga
gagctgttcaacatcccgctgaccgcgcacttcctgggcggcgcggccatcggcgacagc
ccggaaaccggcgtcatcgacccctaccagcgcgtctacaactatccgacgctgcacgtc
atggacggcgcggcgatctcggccaacctcggggtgaacccgtcgctgtccatcacggca
caggccgagcgggcgacgtcgctgtggcccaacaagggcgagcaggatcagcggcccgcc
cagggcgagccgtaccggcggctcgcgccgatcgcgcccgtccgtcccgtggtgcccgcc
gacgctccaggagcgctgcgccggctgccgatcgaacccgtgtcgtcggcggggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system