KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1675Help
Entry
MSMEG_1675        CDS       T00434                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:msm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1767305..1768546
Genome map
AA seq 413 aa AA seqDB search
MLSDDAIDWVIDNYTRGRVADEQMSALLMAIFLRGMTPGEITRWTAAMVNSGERFDFTDL
ERDGRPLALVDKHSTGGVGDKLTIPLVPVVIACGAAVPQAAGRGLGHTGGTLDKLEAIPG
FSAELTKTQIRQQLCGVGAAIFAAGELAPADRKIYALRDVTATTESLPLIASSIMSKKLA
EGARALVLDVKVGRGAFLKTEAESRELARTMVELGNDYGVPTRALLTDMNRPLGLSVGNA
VEVAESLDVLAGGGPADVVELTVALAREMLAAAGIDGVDPAETLRDGSAMDRFRALVAAQ
GGDLSLPLPIGAASETVTAPRGGVMGDIDAMGVAMAAWRLGAGRAQPGEPVQLGAGVRLH
RRPGEPVAAGETLFTLYTDTPDRLPAALGELDGAWSVGDAPPQELPLIIDRID
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccgacgacgccatcgactgggtgatcgacaactacacccgcggccgggtcgcc
gacgaacagatgtcggcgctgctgatggcgatcttcctgcgcggcatgacgccgggcgag
atcacccgctggacggcggccatggtgaactcgggggagcggttcgacttcaccgatctt
gaacgtgacggcaggccactggctttggtcgacaagcactcgaccggtggcgtcggcgac
aaactcaccatcccgctggtgcccgtggtgatcgcgtgcggcgccgccgtgccgcaggcc
gccgggcgcggactcggccacaccggaggcaccctcgacaagctcgaagcgatcccgggg
ttcagcgccgagctcaccaaaacccagatccgccaacagctttgcggggtgggggcggcg
atcttcgccgccggtgagctcgctcccgcagaccgcaagatctacgcactgcgcgacgtc
acggccaccaccgaatccctgcccttgatcgccagctcgatcatgagcaagaaactcgcc
gaaggtgcgcgtgcgctggtgctcgacgtcaaggtcgggcgcggggcgttcctcaagacc
gaggcggagtcccgcgagctcgctcgcaccatggtcgaactcggcaacgactacggcgtg
cccacccgtgcgctgctcaccgacatgaaccggccgctggggctctcggtgggcaatgcg
gtcgaggtcgcggaatccctcgacgtcctcgccggcggcgggcctgccgacgtcgtcgag
ctgaccgtggcgctggcgcgcgagatgctggccgcagcgggcatcgacggtgtcgatccc
gcggagacgctgcgcgacgggtcggccatggatcgcttccgtgccctcgtcgccgcccag
ggcggcgatctcagcctgccgctgccgatcggcgcggcatccgagaccgtcaccgcgccc
cgcggtggcgtgatgggcgacatcgacgcgatgggggtggcgatggccgcctggcgcctg
ggcgccggacgtgcgcagcccggtgaacccgtccaactcggcgccggggtgcggctgcac
cgtcgaccgggggagcctgttgccgccggcgagacactcttcacgctctacaccgacacc
ccggatcggctgcctgccgcgctcggcgagctcgacggcgcctggtccgtcggcgacgcc
ccaccgcaagagctcccgctgatcatcgaccgcatcgactga

DBGET integrated database retrieval system