KEGG   Mycobacterium smegmatis MC2 155: MSMEG_2048Help
Entry
MSMEG_2048        CDS       T00434                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEG_2048
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_2048
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_2048
  Amino acid metabolism
   00350 Tyrosine metabolism
    MSMEG_2048
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEG_2048
   00626 Naphthalene degradation
    MSMEG_2048
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MSMEG_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2125208..2126242
Genome map
AA seq 344 aa AA seqDB search
MRAVVCSTVGVLPRVTEMPDPSCPSDGVLVQVAATGVCRSDWHAWRGHDPVQLPIIPGHE
FAGVIAAVGADVSGWQVGDRVTTPFVLGCGRCEFCRAGDAQVCPNQEQPGFTLPGSFAQL
VAVPRAAANLVRLPDDVSFVAAASLGCRFATAFRALVNHGAVKAGQWVAVHGCGGVGLSA
VMIAKAFGAKVVAVDVTADALAAAQRLGADEIVNSTEIDDVATEIVQRTGGGAHIGVDAV
GNPVSAAASVASLRRRGRHVQVGLLLGADAHTAFPMDRVIAQELAIFGSHGMPAVDYPAM
LDLLASGALQPERLVTRRISLDDAPDALAGMDSFAGSGMTIIEP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgctgtcgtctgttccacggtcggtgtcctgcctcgcgtgaccgagatgcccgat
ccgagttgcccgtccgacggtgtgctggtgcaggtcgcggcaaccggggtgtgccgctcg
gactggcacgcctggcgcggccacgatcccgtgcagttgccgatcatccccgggcacgag
ttcgccggggtgatcgccgcggtgggcgccgacgtctccggatggcaggtgggggaccgg
gtgacgacgccgttcgtcctcggctgcggccgatgcgagttctgccgtgccggcgacgcg
caggtgtgcccgaaccaggagcaacccgggttcacgctgcccgggtcgttcgcacagctg
gtcgcggtgccgcgcgcggccgccaacctggtgcggctgcccgacgacgtgtcgttcgtc
gcggcggcgtcgctggggtgccggttcgcgacggcgttccgggcgctggtcaaccacggt
gcggtaaaggccggccagtgggtcgcggtgcacggctgcggcggtgtcggactttcggcg
gtgatgatcgcgaaggcgttcggcgccaaggtggtcgcggtcgacgtcaccgcagatgcg
ttggcggccgcgcagcgcctgggtgccgacgagatcgtcaacagcaccgagatcgacgac
gtcgcaacagaaatcgttcagcgcacgggtggcggtgcgcacatcggtgtcgacgccgtt
ggcaaccccgtctcggccgcggcatccgtggcctcgctgcgccgccgtggtcgccacgtg
caggtggggttgttgctcggtgccgacgcgcatacggcgtttccgatggaccgcgtgatc
gcacaggaactcgcgatcttcgggtcccacggcatgcccgcggtcgactatcccgcgatg
ctcgacctgctggcaagcggtgcgctgcaacccgaacgcctggtgacgcgccggatcagc
ctcgacgacgcaccggatgcgttggcgggcatggacagtttcgcgggttcggggatgacg
atcatcgaaccctag

DBGET integrated database retrieval system