KEGG   Mycobacterium smegmatis MC2 155: MSMEG_2578Help
Entry
MSMEG_2578        CDS       T00434                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:msm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2660026..2661222
Genome map
AA seq 398 aa AA seqDB search
MTTSAASGEPGRQRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNPELLAAQRAQ
TGVAAVAVADPAAAEAVGDVRYSGPDAVTRLVEDTEADVVLNALVGALGLQPTLAALATG
ARLALANKESLVAGGPLVLKAAAPGQIVPVDSEHSAMAQCLRGGTRAELDKIVLTASGGP
FLGWSAEDLKSVTPEQAGKHPTWSMGPMNTLNSATLVNKGLELIETHLLFGVDYDDIDVV
VHPQSIVHSMATFTDGSTLAQASPPDMKLPIALALGWPDRIAGAAAACDFSTASTWEFLP
LDNAVFPAVDLARFAGKQGGCLTAVYNSANEEAAEAFLDGRIGFPDIVETVGDVLHAADR
WAAEPATVDDVLDAQRWAREQARGVVEQKSVRRGLVTK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacctcagccgcatccggcgaacccgggcgtcaacgggtgctgatcctcggcagc
accggatccatcggtacccaggcgctggaggtgatcgccgccaacccggaccggttcgag
gtcgtgggtctggccgcgggcggcggtaatccggagctactggccgcgcagcgtgcccag
accggtgtggccgccgtcgcggtggccgatccggcggcagccgaggcggtcggcgacgtg
cgctattcggggccggacgcggtgacgcgtctcgtggaggacaccgaggccgatgtcgtc
ctgaacgcgctggtcggggcgctgggactgcagccgacactcgcggcgctggccaccggc
gcgcggctggcgctggcgaacaaggagtccctggtggcgggcgggccgctggtgctcaag
gccgccgcgcccggacagatcgtgccggtggattccgaacactcggccatggcgcagtgc
ctgcgcggcgggaccagggccgaactggacaagatcgtgctcacggcctccggcggcccg
ttcctcggctggtcggccgaggacctcaagtccgtgacgcccgagcaggcgggcaaacac
ccgacctggtcgatgggccccatgaacacgctcaactcggcgacgctggtcaacaagggc
ctcgagctcatcgagacccacctgctgttcggcgtcgactacgacgacatcgacgtcgtg
gtgcacccgcagtcgatcgtgcactcgatggcgacgttcaccgacgggtccacgcttgcg
caggccagcccgccggacatgaaactgccgatcgcgctggcgctgggctggcccgaccgg
atcgccggcgccgcggcggcctgcgacttctccacggcctcgacctgggagttcctgccg
ctggacaacgcggtcttccccgcggtcgacctggcgcggtttgccggtaagcagggcggg
tgcctcaccgcggtctacaactcggccaacgaggaggccgccgaggccttcctcgacggc
cgcatcggcttccccgacatcgtcgaaacagtgggtgacgtgttgcacgccgccgaccgg
tgggccgccgaaccggctaccgtggatgacgtactcgacgcacaacgctgggcccgcgag
caggcccgcggtgtcgtcgagcagaaatccgtcagaagagggctcgtcaccaaatga

DBGET integrated database retrieval system