KEGG   Mycobacterium smegmatis MC2 155: MSMEG_2615Help
Entry
MSMEG_2615        CDS       T00434                                 

Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEG_2615
Enzymes [BR:msm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MSMEG_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2695174..2697057
Genome map
AA seq 627 aa AA seqDB search
MIQQTYPLSAIVGQDRLRLALVLCAVRPEIGGVLIRGEKGTAKSTAVRGLAAVLAAVDED
AKLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDV
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVTASRDVDV
RVEVIRARMDFEADPEGFVRRHAEADAELSRRIAAARDLVDSVVLPDTELRRIAALCAAF
DVDGMRADLVVARTAVAHAAWRGAGTVSEEDVRVAAELALPHRRRRDPFDDPGLDPDRLD
EAMQQAGEQAEAGPESNPETDPETDPDFDPDFDPPGGGATTDSDAAAPQGKPKSSSTRQS
APPAATFRTRALVVPGIGEGAPGKRSRARNRTGKPIAATAEPGEGHGVHVFGTLLATAGR
QREPGRPRPVPEDIRRAVREGREGNLVIFVVDASGSMAARDRMSAVSGAAMSLLRDAYQR
RDKVAVITFRGQDARVLLPPTSSVYIASRRLARFDTGGKTPLAQGLLAARDVVIREKARD
RARRSLVVVLTDGRATGGPDPLQRARRAAAALVAEGTAAVVVDCETSFVRLGLAQELATQ
LGGEAVRLEQLRADELTRLVKTRSDAA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcagacgtatcccctgagcgcgatcgtcgggcaggaccggctgaggctcgcg
ctcgtgctgtgtgccgtgcgtcccgagatcggcggtgtgctgatccgcggcgagaagggc
accgcgaaatccactgctgtgcgcggacttgccgctgtgctcgcagccgtcgacgaggac
gcgaaactggtcgaactgcccatcggcgccaccgaggaccgtgtggtcggctcgctggat
ctgcagaaggtgctgcgcgacggcgaacacgcgttctcgccgggcctgctggcccgcgcg
cacggcggcgtgctgtacgtcgacgaggtgaacctgctgcacgaccacctggtggacgtt
ctgctcgacgcggccgccatgggacgcgtgcacgtcgaacgcgacggcatctcgcactcg
cacgaggcgcggttcgtcctgatcggcaccatgaaccccgaagaaggggaactgcggccc
cagctgctggaccggttcggcctgaccgtcgacgtgaccgcgtcgcgcgacgtcgacgtc
cgagtcgaggtgatccgtgcccgaatggatttcgaggccgacccggagggcttcgtgcgc
cgccacgccgaggccgacgccgagttgtcgcggcgcatcgccgcggcgcgggacctggtc
gactcggtggtgttgcccgacaccgagttacggcgcatcgccgcgctgtgtgcggcgttc
gacgtggacggtatgcgcgccgatctggtcgtggcccgtaccgcggtcgcccacgcggca
tggcgcggggcgggcaccgtgtccgaggaggacgtgcgggtggccgccgagttggcgttg
ccgcaccggcgccgtcgcgatcccttcgacgatcccggactggacccggatcgcctcgac
gaggccatgcagcaggcgggggagcaggccgaggccggtccggaaagcaacccggaaacc
gacccggaaaccgatccggacttcgaccccgatttcgacccacccggcggcggtgccacc
accgattcggatgccgctgcgccgcagggtaagccgaaaagctcctcgacacggcagagc
gcgccgcctgcggcaaccttccgcacaagggcgctcgtggtgcccgggatcggtgagggt
gcccccggtaagcgctcgcgtgcgcgcaaccgcacgggcaagcccatcgccgcgacggca
gaaccgggcgagggccacggtgtgcacgtgttcggcacgctgctcgccaccgccgggcgc
cagcgggaaccgggacggccgcgaccggtgccagaggacatccggcgcgcggtgcgcgaa
ggacgtgagggcaacctggtgatcttcgtcgtcgacgcatcggggtcgatggccgcgcgc
gaccgcatgtccgcggtcagcggggctgcgatgtcgctgctgcgcgacgcctatcagcgt
cgcgacaaggtcgcggtgatcaccttccgcgggcaggacgcccgcgtgctgctgccgccg
acgtcgtcggtgtacatcgcgagccgtcggctcgcgcggttcgacaccggcgggaaaacc
ccgctggcgcagggactcctggccgcccgtgacgtggtgatccgggagaaggcccgtgac
cgggcacgccgcagcctggtggtggtgctcaccgacggccgtgcgaccgggggcccggac
ccgctgcagcgcgccaggcgggccgccgccgcgctggtcgccgagggcacggccgccgtg
gtcgtcgactgcgaaacctcgttcgtgcggctgggtttggcgcaggaactggccacgcag
ctgggcggtgaggccgtacggctggagcagctgcgggcagacgagttgacccggctggtc
aagaccaggtcagacgcggcgtag

DBGET integrated database retrieval system