KEGG   Mycobacterium smegmatis MC2 155: MSMEG_2698Help
Entry
MSMEG_2698        CDS       T00434                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEG_2698
Enzymes [BR:msm01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MSMEG_2698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2772781..2773191)
Genome map
AA seq 136 aa AA seqDB search
MQNPIATVETFLNALQEQDFDTAENALAQNLVYQNVGMPTIYGRNRAMKLFRSMQGRAGF
EVKIHRSAADGAAVLNERTDVLTFGPLRVQFWVCGVFEVHDGRITLWRDYFDYLDIFKAT
VRGLLGMVVPSLRAKL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaacccgatcgccacggtcgagacgttcctcaacgcgctgcaggaacaggacttc
gacaccgcggagaacgcgctggcgcagaacctcgtctaccagaacgtgggcatgccgacc
atctatggtcgcaaccgcgccatgaagctgttccggtccatgcaggggcgggccggtttc
gaggtcaagatccatcgcagcgcggccgacggcgccgcggtgctcaacgagcgcaccgat
gtcctcacgttcggcccgctgcgggtccagttctgggtgtgcggtgtgttcgaggtgcac
gacggccggatcacgctgtggcgcgactacttcgattacctcgacatcttcaaggcgacc
gtgcgtggtctgctcggcatggtcgtcccgtcgctgcgcgccaagctgtga

DBGET integrated database retrieval system