KEGG   Mycobacterium smegmatis MC2 155: MSMEG_2781Help
Entry
MSMEG_2781        CDS       T00434                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00860  Porphyrin and chlorophyll metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEG_2781 (hemG)
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MSMEG_2781 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MSMEG_2781 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Rossmann-like Trp_halogenase FAD_oxidored Pyr_redox MCRA FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 4531258
NCBI-ProteinID: YP_887112
UniProt: A0QW24 I7FCD0
Position
2847863..2849224
Genome map
AA seq 453 aa AA seqDB search
MTMRFCVVGGGISGLVAAYRLRRAAGPHADITLLDPADRLGGILRTERVGGQWLDVGAEA
FVARRPEMPALLAELGLAGRQIATSGARPLIYSGARLHPLPQGTLQGIPAQASSLLGLVD
DATVAQIIDERARPFAWRPGSDPSVADVVGDRFGMQVVYRSVDPLLTGVYAGSSATIGLR
SAVPTLAAALDRGAPSLTDAVRDALPPPVTGSVFGALDGGYRVLLEELQRRAAVRWAQVT
AVRVDRDANGWLVFDDEGTNWNADGVVLAVPAPALPALIEHVAPRTAAAARRIRVASAAV
VALALPGGTPIPQQSGVLVATGEAGSLNAKAVTLSSRKWGRRGNVELLRLSFGRYGDDLA
RSTGDEDLLAWSTRDLNTLFGITVDPVDWHIQRWIDAMPQYGPGHLDLVAELRAGLPPNL
AVTGSYLDGIGVPACVGAATRAALTLVKTGVAR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgcggttctgcgtcgtcggcggcgggatctccggcctcgtcgccgcttaccgc
ttgcgccgggccgcgggtccgcacgccgacatcacgctgctcgacccggccgaccgtctc
ggcgggatcctgcgcaccgagcgcgtcggcgggcaatggctcgacgtcggcgcggaggcg
ttcgtcgcgcgtcggcccgagatgcccgcgctgctggcggaactcggcctggccggacgg
cagatcgcgacctccggtgcgcgtccgctgatctacagcggtgcgcggctgcacccgctg
ccgcagggcaccctgcagggcatcccggcgcaggcgtcgtcgctgctgggtctggtcgac
gacgcgacggtcgcgcagatcatcgacgaacgtgcgcgcccgttcgcgtggcggccggga
tccgatccgtcggtcgccgacgtcgtgggcgaccggttcgggatgcaggtcgtgtaccgc
tcggtcgacccgctgctgaccggggtgtacgccgggtcctcggcgaccatcggattgcgt
tctgcggtaccgaccctggccgcggcgctggaccgcggcgcccccagcctgaccgacgcc
gtgcgtgacgcgctgccgccgccggtcaccggctcggtcttcggcgcgctcgacggcggc
taccgcgtgctgctggaggaactgcagcgccgcgccgccgtgcgctgggcgcaggtcacc
gctgtgcgcgtcgatcgtgacgccaacggctggctggtgttcgacgacgagggcacgaac
tggaacgccgacggtgtggtgctggccgtgcccgcaccggccctgccggccctgatcgag
cacgtcgcgccgaggacggccgcggccgcgcgccggatcagggtggcgtcggcggcggtg
gtggcgctcgcgcttcccggcgggacgccgatcccgcagcagtcgggcgtgctggtggcc
accggcgaggcgggcagcctcaacgccaaggccgtgaccctgtcgtcacgcaagtggggc
cggcgcggcaatgtcgaactgctgcggttgtcgttcggtcgctacggcgacgatctcgcc
cgcagcacgggcgacgaggatctgctggcgtggtcgacgcgcgatctgaacacgctgttc
ggcatcacggtcgaccccgtcgactggcacatccagcggtggatcgacgccatgccgcag
tacggcccgggccacctggatctggtggccgaactgcgtgcgggactgccgccgaatctc
gcggtgacgggcagttatctcgacggcatcggggtcccggcatgtgtgggcgcggccacc
cgagcggccctgacgctggtgaaaaccggcgtggcacgatag

DBGET integrated database retrieval system