KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3031Help
Entry
MSMEG_3031        CDS       T00434                                 

Gene name
aroK
Definition
shikimate kinase (EC:2.7.1.71)
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEG_3031 (aroK)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3031 (aroK)
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MSMEG_3031 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3103991..3104725
Genome map
AA seq 244 aa AA seqDB search
MAPRAVLIGLPGSGKSTIGRRLAKVLDVSMLDTDAVIEETAGRTIADIFATDGEKEFRRI
EEEVIRSALQTHDGVLSLGGGAVTTPGVREALAGHTVVYLEISAAEGVRRTGGSTVRPLL
AGGDRAEKYRKLMAERVPLYRKVATIRINTNRRNPGAVVRTIVARMENPQQAKPVAAART
PKPGKPRRRRRPPWRRTGKNGKNGSAEPKAETAGDSGIASAATTTKVTPTPAALAARNVE
RHND
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgggcggtactgatcggcctgcccggttcgggcaagtcgaccatcggccgc
cgcctcgccaaggtgctcgacgtgtcgatgctcgacaccgacgcggtgatcgaggagacc
gccggccgcacgatcgccgacatcttcgccaccgacggtgagaaggagttccggcggatc
gaggaggaagtgatccgctcggcgttgcagacccacgacggcgtgctgtctctcggcggc
ggtgccgtgacgacgccgggcgtgcgtgaagcgctcgccgggcacaccgtggtgtacctg
gagatcagcgccgccgagggggtgcgccgcaccggcgggagcacggtccggcccctgctc
gcgggcggggaccgcgccgagaagtaccgcaagctcatggcggagcgggttccgctgtac
cgcaaggtcgccacgatccgcatcaacaccaaccggcgcaatcccggcgccgtcgtccgc
acgatcgttgcgcggatggagaatccgcagcaggccaaacctgtcgccgcggcacgcacg
cccaagccgggcaaaccgcgccgcaggcgccgtccgccgtggcgccgcacgggcaagaac
ggcaagaacggatccgccgagcccaaggccgaaacggcaggcgattcaggcatcgcgtcg
gcagcgacgacaaccaaggtgacacccacccccgcggccctggccgcccgtaatgtggag
cgacacaatgactga

DBGET integrated database retrieval system