KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3031Help
Entry
MSMEG_3031        CDS       T00434                                 

Gene name
aroK
Definition
shikimate kinase (EC:2.7.1.71)
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msm01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:msm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3103991..3104725
Genome map
AA seq 244 aa AA seqDB search
MAPRAVLIGLPGSGKSTIGRRLAKVLDVSMLDTDAVIEETAGRTIADIFATDGEKEFRRI
EEEVIRSALQTHDGVLSLGGGAVTTPGVREALAGHTVVYLEISAAEGVRRTGGSTVRPLL
AGGDRAEKYRKLMAERVPLYRKVATIRINTNRRNPGAVVRTIVARMENPQQAKPVAAART
PKPGKPRRRRRPPWRRTGKNGKNGSAEPKAETAGDSGIASAATTTKVTPTPAALAARNVE
RHND
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgggcggtactgatcggcctgcccggttcgggcaagtcgaccatcggccgc
cgcctcgccaaggtgctcgacgtgtcgatgctcgacaccgacgcggtgatcgaggagacc
gccggccgcacgatcgccgacatcttcgccaccgacggtgagaaggagttccggcggatc
gaggaggaagtgatccgctcggcgttgcagacccacgacggcgtgctgtctctcggcggc
ggtgccgtgacgacgccgggcgtgcgtgaagcgctcgccgggcacaccgtggtgtacctg
gagatcagcgccgccgagggggtgcgccgcaccggcgggagcacggtccggcccctgctc
gcgggcggggaccgcgccgagaagtaccgcaagctcatggcggagcgggttccgctgtac
cgcaaggtcgccacgatccgcatcaacaccaaccggcgcaatcccggcgccgtcgtccgc
acgatcgttgcgcggatggagaatccgcagcaggccaaacctgtcgccgcggcacgcacg
cccaagccgggcaaaccgcgccgcaggcgccgtccgccgtggcgccgcacgggcaagaac
ggcaagaacggatccgccgagcccaaggccgaaacggcaggcgattcaggcatcgcgtcg
gcagcgacgacaaccaaggtgacacccacccccgcggccctggccgcccgtaatgtggag
cgacacaatgactga

DBGET integrated database retrieval system