KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3051Help
Entry
MSMEG_3051        CDS       T00434                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:msm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3125301..3125903
Genome map
AA seq 200 aa AA seqDB search
MTVGRGAGQRATDGPARARVVVLSGPSAVGKSTVVRCLRERLPDLYFSVSVTTRAPRPGE
VDGVDYTFVSPERFQQLIDDGELLEWAEIHGGLHRSGTPAAPVREATRAGRPVLIEVDLA
GARAVKQAMPEVVSVFLAPPSWDELVRRLSGRGTETPEVMARRLDTARAEMAAQSDFDRV
VVNRQLDSACAELVSLLVDS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtcggccgtggggccggacaacgcgcgactgatgggcccgcacgggcccgggtc
gtcgtgctgtccggcccctcagctgtcgggaagtcaaccgtggtccgctgtctgcgggaa
cggcttcctgacctgtacttttccgtgtccgtcaccaccagggcgccccgtcccggggag
gtcgacggcgtggactacacctttgtcagcccggaacgcttccagcagttgatcgacgac
ggggaactgctcgaatgggccgagatccacggcggtctgcaccgctcgggcacgcccgcc
gcaccggtccgtgaggccaccagggcaggccgaccggtactgatcgaggtcgacctggcc
ggcgcgagggccgtcaagcaggccatgcccgaggtcgtctcggtgttcctggccccgccg
agctgggacgaactcgtgcgccgcctgtccggccgcggcaccgaaacgcccgaggtgatg
gcccggcgcctggacaccgccagagccgaaatggctgcacaatccgatttcgaccgcgtc
gtggtgaaccggcagttggattcggcatgcgcggaattggtatccttgctggtggacagc
tga

DBGET integrated database retrieval system