KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3086Help
Entry
MSMEG_3086        CDS       T00434                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_3086 (tpiA)
   01230 Biosynthesis of amino acids
    MSMEG_3086 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_3086 (tpiA)
   00051 Fructose and mannose metabolism
    MSMEG_3086 (tpiA)
   00562 Inositol phosphate metabolism
    MSMEG_3086 (tpiA)
Enzymes [BR:msm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSMEG_3086 (tpiA)
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSMEG_3086 (tpiA)
  Exosomal proteins of bladder cancer cells
   MSMEG_3086 (tpiA)
  Exosomal proteins of melanoma cells
   MSMEG_3086 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3159535..3160320
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSQHDSGAYTGEISGAFLAKLGCTFVIVGHSERRTYHGETDELVAAKAKA
AHKHGLTPIVCIGEQLEVREAGNHVEFNVNSLRGSLAGLTPEQIGQTVIAYEPVWAIGTG
RVAGAADAQEVCKAIRGELANLSSSEIAAGVRVLYGGSVNAKNVGEIVSQGDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagcccctcatcgcgggcaactggaagatgaacctcaaccacttcgaggcc
atcgctctggtgcagaagatcgcattcgccttgccggacaagtacttcgacaaggtcgat
gtgaccgtcatcccgccgttcaccgatctgcgcagcgtgcagaccctggtcgacggggac
aagctgcggctcacctacggtgcgcaggacctgtcccagcacgattcgggggcctacacc
ggcgagatcagcggtgcgttcctggcgaagctggggtgcacgttcgtcatcgtcggccac
tcggagcgtcgcacctatcacggtgagaccgacgaactggtcgcggcgaaggccaaggcc
gcgcacaagcacggcctgacgcccatcgtgtgcatcggcgagcaactcgaggtgcgcgag
gcgggcaaccacgtcgagttcaacgtgaactcgctgcgcgggtcgctcgcggggctcacg
cccgagcagatcggccagaccgtgatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggggccgccgacgcgcaggaggtctgcaaggccatccgcggcgaactggcc
aacctttcctcgtccgagatcgcggcgggcgtgcgggtgctctacggcggctcggtgaac
gcgaagaacgtcggcgagatcgtctcgcagggcgatgtggacggtgcgctggtcggcggg
gcgtccctggacggcgagcagttcgcgacgctgtccgcgatcgccgcgggcggaccactt
ccgtaa

DBGET integrated database retrieval system