KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3205Help
Entry
MSMEG_3205        CDS       T00434                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:msm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3284200..3285537
Genome map
AA seq 445 aa AA seqDB search
MNMMAKFQMSRIDLRNRVLSAAQLRSALPRGGVDVDAVVPKVRPIVDAVAQRGAQAALEY
GESFDGIRPETVRVPRELLSQALENLDADVRAALQVSIDRARAVHADQRRTDTTTTLAPG
ATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSMVIASPPQGQFGGRPHPT
ILAAAALLGVDEVWAVGGAQAVALLAYGGTDTDGAELAPVDMITGPGNIYVTAAKRICRS
QVGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDEMAASVLVTDSETLAEATDRELA
NQLATTKHVERVTAALSGKQSAIVLVDDIDAGVRTVNAYAAEHLEIQTVDAPGVAGRIRS
AGAIFVGAWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYDEAALKDVS
GHVITLSKAEDLPAHGEAVRRRFER
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatggccaagtttcagatgtcccgcatcgacctgcgcaaccgtgtgctcagc
gcggcgcaactgcgctccgccctgccgcgcggtggagtcgacgtcgacgccgtggtgccc
aaggtccgcccgatcgtcgacgcggtcgcacagcggggcgcgcaggccgccctggagtac
ggcgaatccttcgacggcatccgcccggagacggtgcgggtgccgcgcgagttgctcagc
caggcgctggagaacctcgacgccgacgtgcgcgccgcgctgcaggtctccatcgaccgt
gcgcgtgccgtgcatgctgatcagcgtcgcaccgacaccaccaccacactggcgcccggc
gccaccgtgaccgagcgctgggttccggtcgagcgggtcggcctctacgttccgggcggc
aacgccgtctatccgtcgagcgtcgtgatgaacgtcgtgcccgcccagaccgcgggcgtg
gactcgatggtcatcgccagtccgccgcagggccagttcggcggcaggccgcacccgacc
atcctcgccgcggccgcgttgctcggtgtcgacgaggtgtgggcggtcggcggcgcacag
gccgtggcgcttttggcctacggcggcaccgacaccgacggcgccgaactcgcgccggtc
gacatgatcaccggtccgggcaacatctacgtgacggccgccaagcgcatctgccgctcc
caggtcggcatcgacgccgaggccggccccaccgagatcgcgatcctggccgaccacacg
gccgatccggtgcacgtggccgccgatctgatcagccaggccgagcacgacgagatggcc
gccagcgtgctggtcaccgacagtgagacgctggccgaggccaccgaccgcgaactggcc
aaccagctcgccaccaccaagcacgtcgagcgggtcaccgcggcactctcgggcaaacag
tccgcgatcgttctggtcgacgacatcgacgcgggcgtgcgcaccgtcaacgcctacgcc
gccgagcatctcgagatccagaccgtcgacgcccccggcgtggccggccggatccgttcg
gccggagccattttcgtgggcgcctggtcaccggtgagcctcggcgactactgcgccggg
tccaaccacgtgctgcccaccgcgggatgcgcgcggcactccagtgggctgtcggtgcag
acgttcctgcgtggcatccacgtcgtcgagtacgacgaggcggcgctcaaagacgtttcg
gggcacgtgatcacgctgtccaaggccgaggatctgcccgcgcacggcgaggcggtacga
cggaggttcgagcggtaa

DBGET integrated database retrieval system