KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3219Help
Entry
MSMEG_3219        CDS       T00434                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEG_3219 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3219 (trpC)
Enzymes [BR:msm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MSMEG_3219 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3297046..3297864
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSIIEGVRADVAAREAVISLDEIKERAKAAPPPLNVMAALREPGIGVIAEVKR
ASPSRGALASIGDPAELAQAYQDGGARVISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADMLLLIVAALDQPVLESLLERTESLGMTALVEVHTEEEADRALK
AGASVIGVNARDLKTLEVDRTVFSRIAPGLPSNVIRVAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRSAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggccacagtgctcgactccatcatcgagggagtccgcgccgatgtagccgcc
cgcgaggccgtcatcagccttgacgagatcaaagagcgggccaaggcggcgccaccgccg
ctgaacgtgatggccgccctgcgggaaccgggaatcggtgtcatcgcggaggtcaagcgc
gcgagtccctcgcggggcgcactggcctcgatcggcgatcccgccgagttggctcaggca
taccaggacggcggcgcgcgcgtgatcagcgtgctgaccgagcagcgcaggttcaacggc
tcgttggacgacctcgacgcggttcgggcagcggtgtcgattccggtgctgcgcaaggac
ttcatcgtccggccgtaccagatccacgaggccagggcacacggtgccgacatgctgctg
ctgatcgtggccgcgctcgaccagcccgtgttggagtcgctgctggagcgcaccgaatcc
ctggggatgaccgctctggtcgaggtgcacaccgaggaagaggccgaccgcgcgctgaag
gcgggcgcgtcggtgatcggggtcaacgcccgcgacctcaagaccctcgaggtggaccgc
accgtcttcagccggatcgctccgggccttcccagcaacgtcatccgtgtcgcggaatcc
ggcgtgcgcggtacggccgacctgctggcctacgcgggcgcgggcgccgacgcggtgctc
gtcggggagggcctggtgaccagcggggatccccgcagcgcggtcgccgatctggtcacc
gcaggcacgcacccgtcctgcccgaaaccggcccgctga

DBGET integrated database retrieval system