KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3220Help
Entry
MSMEG_3220        CDS       T00434                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEG_3220 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_3220 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3220 (trpB)
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSMEG_3220 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3297900..3299177
Genome map
AA seq 425 aa AA seqDB search
MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKCRGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQVQD
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGVRLIGFEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFRL
LCRTEGIIPAIESAHAVAGALKLGPELGAGSVIVVNLSGRGDKDVETAAKWFGLLDEGQG
EGEAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcacgccggcccggacctgccgcgttccagcgcgggggtggccgaacccacg
tcccacgaccccgacgcgcgcgggcacttcggtccgtacggcggccgcctcgtccccgag
gcgctgatggcggtgatcgaagaggtcaccgccgcctacgagaagtgccgcggcgaccag
acgttcctcgacgaactcgaccgcctgcagcgtcactacagcggcaggccgtcgccgctg
tacgaggcgacgcggttgtccgagcacgccggcggcgcgcgcatcttcctcaagcgggaa
gacttgaaccacaccggatctcacaagatcaacaacgtgctggggcaggccctgctggcg
cgtcagatgggcaagacgcgcgtcatcgccgagaccggcgccggtcagcacggcgtggcc
accgcgaccgcgtgtgccctgctgggactcgagtgcgtcatctacatgggcgcggtcgac
acggcccgccaggcgctcaacgtcgcccgcatgcgactgctcggcgcgaccgtggtgtcg
gtcgaggccggttccaagaccctcaaggacgccatcaacgaggcgttccgcgactgggtg
accaacgccgacgagacgtactactgcttcggcaccgccgcgggcccgcatccgttcccg
ctcatggtccgtgacttccagcggatcatcggcctggaggcccgggttcaggtccaggac
caggccgggcggctgcccgacgcggtgaccgcatgcgtcggcggcggctcgaacgccatc
ggcatcttccacgccttcatcgacgatccgggtgtccgtctgatcggattcgaggccgca
ggcgacggcgtggagaccggcaggcacgccgcgaccttcaccggtggttcgcccggcgcg
ttccaggggtcgttctcctacctgttgcaggacgaggacgggcagaccatcgagtcccat
tcgatctcggcgggtctggactacccgggcgtcggacccgagcacgccctgctcaaggac
atcgggcgcgccgaataccggcccatcaccgacaccgaggccatggacgccttccgcctg
ctgtgccgcaccgaggggatcatcccggcgatcgaatccgcgcacgccgtggcgggtgcg
ctcaagctgggccccgaactcggcgcgggatcggtcatcgtggtgaacctgtccggacgt
ggtgacaaggacgtcgagaccgcggccaagtggttcggcctgctcgacgaaggacagggc
gaaggagaagcccgatga

DBGET integrated database retrieval system