KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3220Help
Entry
MSMEG_3220        CDS       T00434                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:msm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:msm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3297900..3299177
Genome map
AA seq 425 aa AA seqDB search
MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKCRGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQVQD
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGVRLIGFEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFRL
LCRTEGIIPAIESAHAVAGALKLGPELGAGSVIVVNLSGRGDKDVETAAKWFGLLDEGQG
EGEAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcacgccggcccggacctgccgcgttccagcgcgggggtggccgaacccacg
tcccacgaccccgacgcgcgcgggcacttcggtccgtacggcggccgcctcgtccccgag
gcgctgatggcggtgatcgaagaggtcaccgccgcctacgagaagtgccgcggcgaccag
acgttcctcgacgaactcgaccgcctgcagcgtcactacagcggcaggccgtcgccgctg
tacgaggcgacgcggttgtccgagcacgccggcggcgcgcgcatcttcctcaagcgggaa
gacttgaaccacaccggatctcacaagatcaacaacgtgctggggcaggccctgctggcg
cgtcagatgggcaagacgcgcgtcatcgccgagaccggcgccggtcagcacggcgtggcc
accgcgaccgcgtgtgccctgctgggactcgagtgcgtcatctacatgggcgcggtcgac
acggcccgccaggcgctcaacgtcgcccgcatgcgactgctcggcgcgaccgtggtgtcg
gtcgaggccggttccaagaccctcaaggacgccatcaacgaggcgttccgcgactgggtg
accaacgccgacgagacgtactactgcttcggcaccgccgcgggcccgcatccgttcccg
ctcatggtccgtgacttccagcggatcatcggcctggaggcccgggttcaggtccaggac
caggccgggcggctgcccgacgcggtgaccgcatgcgtcggcggcggctcgaacgccatc
ggcatcttccacgccttcatcgacgatccgggtgtccgtctgatcggattcgaggccgca
ggcgacggcgtggagaccggcaggcacgccgcgaccttcaccggtggttcgcccggcgcg
ttccaggggtcgttctcctacctgttgcaggacgaggacgggcagaccatcgagtcccat
tcgatctcggcgggtctggactacccgggcgtcggacccgagcacgccctgctcaaggac
atcgggcgcgccgaataccggcccatcaccgacaccgaggccatggacgccttccgcctg
ctgtgccgcaccgaggggatcatcccggcgatcgaatccgcgcacgccgtggcgggtgcg
ctcaagctgggccccgaactcggcgcgggatcggtcatcgtggtgaacctgtccggacgt
ggtgacaaggacgtcgagaccgcggccaagtggttcggcctgctcgacgaaggacagggc
gaaggagaagcccgatga

DBGET integrated database retrieval system