KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3221Help
Entry
MSMEG_3221        CDS       T00434                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEG_3221 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_3221 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3221 (trpA)
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSMEG_3221 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3299174..3299962
Genome map
AA seq 262 aa AA seqDB search
MSRLGAMFDSCRAEDRAALIGYLPTGFPDVPTSIAAMTALVESGCDLVEVGVPYSDPGMD
GPTIAAATETALAGGVKVRDTLTAVEAISNAGGRAVVMTYWNPVLRKGVDAFARDLANAG
GYGLITPDLIPEEADEWMAASEANDLDRIFLVAPSSTHERLAKTIEVSRGFVYAASTMGV
TGARDAVSSSAPELVRRIREVSDIPVGVGLGVRSGEQAAQIGSYSDGVIVGSALVAALQD
GVDAVSRLTEELAGGVRRRVSA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactgggcgcaatgttcgacagctgccgcgccgaagaccgcgccgcgctgatc
ggttacctgccgaccgggttccccgatgtgccgacctcgatcgccgcgatgaccgcactg
gtcgaatccggttgcgatctggtcgaagtcggcgtcccgtactccgatcccggcatggac
ggcccgacgatcgccgcggcgaccgagacggcgctcgccggcggggtcaaggtgcgtgac
accctgaccgcagtcgaggccatcagcaacgctggcggccgcgccgtggtgatgacgtac
tggaatccggtgctgcgcaagggtgtcgacgcctttgcgcgtgacctggccaatgcgggc
ggctacggtctgatcaccccggacctgatccccgaggaagccgacgagtggatggcggct
tccgaggcgaacgacctcgaccgcatcttcctggtcgccccgtcgtcgacgcacgaacgc
ctcgccaagaccatcgaggtgagccgcggattcgtctacgccgcctcgaccatgggtgtg
accggcgcccgcgacgcggtgtcgtcgtcggcccccgaactggtgcggcgcatccgcgag
gtgtccgacatcccggtcggggtcggcctcggcgtgcgttcaggtgagcaggccgcccag
atcgggtcgtacagtgacggcgtgatcgtgggctcggcattggtcgccgcactgcaggac
ggtgtggatgcggtgagccgcctgaccgaagaactcgccggtggtgttcggcggagggtg
tcagcttga

DBGET integrated database retrieval system