KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3309Help
Entry
MSMEG_3309        CDS       T00434                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00260  Glycine, serine and threonine metabolism
msm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01130  Biosynthesis of antibiotics
msm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_3309
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3309
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSMEG_3309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 4530892
NCBI-ProteinID: YP_887618
UniProt: A0QXI0 I7G1M3
Position
3388626..3389927
Genome map
AA seq 433 aa AA seqDB search
MTLHADAAHPDLVTVEVPTHWYNLAAELDQPIPPHLHPATKEPVGPDDLAALFPSGLIAQ
EVSTEAYIAIPDPVREIYSMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNSVDGVRKLTTETGAGQWGSALAFAGAQFGLEIEVWQVRASYESKPYRGHLIRT
YGGVVHSSPSELTESGRAILAKDPNTTGSLGMAVSEAVEVAAGDPDTRYALGSVLNHVVL
HQSVIGQEAVAQLAAVEPNGADLVFGCAGGGSNLAGLAFPFLREKIHGRSDPKVIAAEPA
ACPSITQGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VQGVAISQHDAFSAGVQFARTQGIVPAPESTHAIAAAAAHVADDPSEQVVVIGLSGHGQL
DLPAYAEYLDGKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcacgccgacgctgcccatccggatctggtgaccgtcgaggtgccgacacat
tggtacaaccttgccgccgagttggatcagccgatcccgccgcacctgcacccggccacc
aaggaaccggtcggtcccgacgacctcgcggcactcttcccgagtggtctcatcgcgcag
gaggtctccaccgaggcctacatcgccatccccgatccggtgcgcgagatctactcgatg
tggcggccgtcgccgctgatccgggcgcggcggttcgaaaaggcgctcaacaccggggcc
cacatctacgtcaagtacgagggtgtcagcccggtgggtagccacaagacgaattctgct
gtcgcgcaggcctattacaacagcgtggacggggtccgcaagctcaccaccgagaccggt
gccggccagtggggcagtgcgctggcgttcgccggggcgcagttcggcctggagatcgag
gtgtggcaggtgcgcgcgtcgtacgagtcgaagccgtaccgcggccacctcatccggacc
tacggcggtgttgtccattccagcccgtcggaactgaccgaatcgggccgcgcgatcttg
gcgaaggatccgaacacgacaggcagcctcggtatggcggtcagtgaggccgtcgaggtc
gccgccggggatccggacacccgttacgccctcggcagtgtgctcaaccatgttgtgctg
caccagagtgtcatcggccaggaggccgtcgcgcagttggccgcagtcgaaccgaacggc
gcagacctcgtgttcggttgcgcgggaggaggttccaacctcgccgggttggctttcccg
ttcctgcgtgagaagatccacggtcgttccgacccgaaggtgatcgcggccgaaccggcg
gcgtgcccgtcgatcacccagggggagtaccgctacgaccacggtgatgtcgcaggtctc
acgccactgctgaaaatgcacacgctcggaatggatttcgtgcccgatcccatccacgcg
ggcggtctgcgctatcacgggatggcgcccgcgctcagccacaccgtcgaactcggcctc
gtccagggcgtggccatctcacagcacgatgcgttctccgcgggtgtgcagttcgcgcgg
acgcagggcatcgtgccggcgccggagtcgacgcatgcgatcgccgcggccgcggcgcac
gtggcagacgatccgtcggagcaggtcgtcgtgatcggtctatccggacacggccaactc
gacctgccggcgtacgccgagtatctcgacgggaagttctga

DBGET integrated database retrieval system