KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3464Help
Entry
MSMEG_3464        CDS       T00434                                 

Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEG_3464
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_3464
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_3464
  Amino acid metabolism
   00350 Tyrosine metabolism
    MSMEG_3464
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEG_3464
   00626 Naphthalene degradation
    MSMEG_3464
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MSMEG_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3531027..3532043)
Genome map
AA seq 338 aa AA seqDB search
MPTHRAVHVKSTGGTLELTDVETPPPDRGQVRIDVAACGVCGTDRGIVNGVFPVASWPVT
PGHEIAGTVAEIGPGVEDFAVGDRVAIGWFGGHCGTCVPCRKGLFIHCVNGQVPSLSYPG
GYAESVTAPANALARIPDELSFVEAAPMGCAGVTTYNALRHTRAVAGDVVAIIGLGGLGH
LGVQFAAAMGFDTVVIARGRGDREQDARALGARHYIDSTSEDVAAALQDLGGAAVVLGTA
GNSQAMADTIGGLAPRGELVAVGVSAEPLGVSPAQLIQPAVSISGHPSGTAREVEETMHF
AVVAGVRARVEERPLDDAAEAYGAMADGRARYRFVLTT
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcccactcatcgagcagtacacgtgaaatccaccggtggaacgctggaactcaccgat
gtcgagaccccgcctcccgaccggggccaggtccgcatcgacgtcgcggcatgcggggtc
tgcggcaccgacaggggaatcgtcaacggcgtcttcccggtcgcctcgtggcctgtcacc
cccggacacgagatcgcgggcaccgtggccgaaatcgggcccggcgtcgaggatttcgcg
gtcggtgaccgtgtcgccatcggctggttcggcggccactgcggcacctgcgtgccctgt
cgcaaggggctcttcatccactgtgtcaacggacaggtgcccagcctgagctatccgggt
ggatatgccgagtcggtgaccgcgcccgccaacgcgctggcccgcatccccgacgagttg
agcttcgtcgaggccgccccgatggggtgcgcaggggtcaccacctacaacgcgctgcgc
cacacgcgcgccgtcgccggtgacgtcgtggcgatcatcgggctcggcgggctcgggcac
ctcggtgtgcagttcgctgccgcaatgggattcgacaccgtcgtgatcgctcgcggtcgc
ggcgaccgcgagcaggacgcccgcgcgctcggtgcgcggcactacatcgactcgacgagc
gaggacgtcgcggccgcactgcaggacctcggcggcgcagcggtggtactcggcaccgcg
ggcaactcgcaggccatggccgacacgatcggcgggctcgcaccgcgcggcgaactcgtc
gcggtgggggtcagcgccgaacccctgggggtcagtcccgcgcagttgatccagcccgcg
gtgagcatctcgggacatccgtcaggaaccgcacgcgaggtcgaggagaccatgcacttc
gcggtggtggccggtgtccgtgcccgcgtcgaggaacgcccgctcgacgatgccgccgag
gcgtacggcgcgatggccgacggtcgggcccgctaccggttcgtgctgaccacctga

DBGET integrated database retrieval system