KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3535Help
Entry
MSMEG_3535        CDS       T00434                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3597069..3598112
Genome map
AA seq 347 aa AA seqDB search
MGDDHGHEHGPRRELPPGLAEQLDLPYAGMVSFGHRPFLTETQQLDEWRPDVAIVGAPFD
IATTNRPGARFGPRAIRATAYEPGTYHLDLGLEIFDWLEVVDFGDAYCPHGQTEVSHANI
RERVHAVASRGVVPVVLGGDHSITWPSATAVADVHGYGNVGIVHFDAHADTADNIEGNLA
SHGTPMRRLIESGAVPGSHFVQVGLRGYWPPQDTFEWMLEQKMTWHTMQEIWDRGFKAVM
DDAVGEALAKAEKLYLSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCHRHDVAGV
DVVEVAPAYDHAELTVNAAHRVVFEALAGMAARRRDAAQAQPGPPAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgatcacgggcacgagcacgggccgcggcgtgagctgccgcccggactggcc
gaacaactcgaccttccctacgcgggcatggtgtcgttcgggcaccggccgtttctgacc
gagacacagcaactcgacgagtggcgtcccgacgtcgcgatcgtcggagccccgttcgac
atcgcgaccaccaaccgcccgggcgcgcgcttcggcccgcgcgcgatccgcgcgacggcc
tacgaaccgggcacctatcacctggatctcggcctggagatcttcgactggctcgaggtg
gtcgatttcggtgacgcgtactgcccacacgggcagaccgaggtgtcgcacgccaacatc
cgtgagcgcgtgcacgcggtcgcgtcccgcggcgtcgtcccggtggtgctcggcggggac
cattccatcacctggccgtcggcgaccgccgtggccgatgtgcacggctacggcaacgtc
ggcatcgtgcatttcgacgcccacgccgacacggccgacaacatcgagggcaacctcgcg
agccacggcaccccgatgcgccggctcatcgaatcgggcgccgtgcccggcagccacttc
gtacaggtcgggctgcggggttactggccgccgcaggacacgttcgagtggatgctcgaa
cagaagatgacctggcacaccatgcaggagatctgggaccgcggattcaaggccgtgatg
gacgacgcggtcggcgaggcgctggcgaaggccgaaaagctctatctctccgtagatatc
gatgttctggacccggcgcacgcgcccggcacgggaactcccgagccgggcgggatcacc
agcgccgacctcttacgcatggtccggcagttgtgtcaccgccacgacgtggccggcgtc
gacgtggtcgaggtcgcgcccgcctacgaccacgccgaactgacagtgaacgccgcgcac
cgcgtggtgttcgaggcgctcgcgggtatggcggcgcgcaggcgtgacgcggcacaggcc
cagccggggccacccgcgcgatag

DBGET integrated database retrieval system