KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3640Help
Entry
MSMEG_3640        CDS       T00434                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00620  Pyruvate metabolism
msm00630  Glyoxylate and dicarboxylate metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEG_3640 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEG_3640 (glcB)
Enzymes [BR:msm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MSMEG_3640 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DivIC
Motif
Other DBs
NCBI-GeneID: 4537600
NCBI-ProteinID: YP_887943
UniProt: A0QYF5
Position
3703284..3705449
Genome map
AA seq 721 aa AA seqDB search
MAKVLHDFITNEALPGTGVDPDSFWSGVDKVVSDLTPKNQELLARRDELQAQIDKWHRSH
VLEPVDPVAYKQFLTDIGYLLPEPEDFTITTAGVDDEITTTAGPQLVVPILNARFALNAA
NARWGSLYDALYGTDVISEEDGAEKGTGYNKIRGDKVIAYARGFLDEVVPLAEGSWSEAT
GLKIDDGALEVALGDDKVTGLSVPEAFVGYTGELGEPQWSVLLRNHGLHIEILIDPSSPV
GSTDSAGIKDVVLESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDLTEEVTKGDKT
FTRVLNDDRVFKTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDADGNEIPEGIQDALFT
SLIAMHGLKAGDQNGPLTNSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPANTLK
VGIMDEERRTSVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQPW
ILAYEDANVDVGLAAGFSGKAQIGKGMWAMTDLMADMVEQKIGQPKAGATTAWVPSPTAA
TLHAMHYHQVDVFAVQSELAGKKRGKLEDLLTIPLADSSLTWSPEEIHEEVDNNCQSILG
YVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVKTSLRRMAA
VVDEQNAGDPAYLPMAPNPDASIAFAAAQELILSGTQQPNGYTEPILHRRRREFKARAAA
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggtgctgcacgacttcatcaccaacgaggcgctgccgggtactggcgtagac
cccgacagcttctggtcgggtgtcgacaaggtggtctccgacctgaccccgaagaaccag
gaactgctggcgcgccgcgacgaactgcaggcgcagatcgacaagtggcaccgctcgcac
gtgctcgagccggtggacccggtcgcctacaagcagttcctcaccgacatcggctacctg
ctgccggagcccgaggacttcaccatcaccaccgcaggtgtcgacgacgagatcaccacc
accgcgggcccgcagctcgtggtgccgatcctcaacgcgcgcttcgccctcaacgccgca
aacgcacgctggggttcgctgtacgacgcgctgtacggcaccgacgtcatctccgaggag
gacggcgccgagaagggcacggggtacaacaagatccgtggcgacaaggtgatcgcctac
gcgcgcggattcctcgacgaggtcgtgccgctggccgagggttcgtggagcgaggccacc
ggtctgaaaatcgacgacggcgcactggaagtcgcgctcggcgacgacaaggtcaccgga
ctctcggtgcccgaggcgttcgtcggctacaccggcgaactcggcgagccgcagtggtcg
gtgctgctgcgcaatcacgggctgcacatcgagatcctcatcgacccgtcctcgcccgtc
ggctcgaccgactccgcaggcatcaaggacgtcgtgctggagtccgcggtcaccacgatc
atggacttcgaggattcggtcgccgcggtcgacgccgacgacaaggtgctcggctaccgc
aactggctgggcctgaaccgcggtgacctcaccgaagaggtcaccaagggcgacaagacc
ttcacgcgtgtcctcaacgacgaccgcgtgttcaagacccccgacggcgaaggtgagctg
accctgcccggtcgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaacgac
gcgatcgtcgacgccgatgggaacgagatccccgaaggcatccaggacgcgttgttcacc
agcctgatcgcgatgcacggcctcaaggccggcgaccagaacggcccgctgaccaacagc
cgcacgggttcgatctacatcgtcaaacccaagatgcacggccccgacgaggtcgccttc
acctgtgagctgttcagccgcgtcgaggacgtgctcggcctgcccgccaacaccctcaag
gtcggcatcatggatgaggagcggcgcacctcggtcaacctcaaggcctgcatcaaggcc
gccgccgaccgcgtggtgttcatcaacaccggattcctcgaccgcaccggcgacgagatc
cacacctcgatggaagccgggcccatggtgcgcaagggcaccatgaagagccagccctgg
atcctggcctacgaggacgccaacgtcgacgtcggtctggccgccgggttctccggcaag
gcccagatcggcaagggcatgtgggccatgaccgacctgatggccgacatggtcgagcag
aagatcggccagcccaaggccggcgccaccaccgcgtgggtgccctccccgactgccgcc
acgctgcacgcgatgcactaccaccaggtcgacgtgttcgcggtgcagtccgaactcgcg
ggcaagaagcgcggcaagctcgaagacctgctgaccatcccgctggccgactcgtcgctg
acgtggtcgcccgaggagatccacgaagaggtcgacaacaactgccagtcgatcctgggc
tacgtggtgcgctggatcgacgccggtgtcggctgttcgaaggtccccgacatccacgac
gtcgcactcatggaggaccgcgcgacgctgcggatctccagccagctgctggccaactgg
ctgcgccacggtgtgatcaccgaggaggacgtcaagaccagcctgcggcgcatggcggcc
gtggtcgacgagcagaacgcgggcgatccggcgtacctgccgatggcgccgaaccccgac
gccagcatcgccttcgccgccgcgcaggagctgatcctgtcgggcacacagcaacccaac
ggctacaccgaaccgatcctgcaccggcgccgccgcgagttcaaagcccgcgccgctgcg
cagtga

DBGET integrated database retrieval system