KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3640Help
Entry
MSMEG_3640        CDS       T00434                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:msm01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:msm00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:msm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3703284..3705449
Genome map
AA seq 721 aa AA seqDB search
MAKVLHDFITNEALPGTGVDPDSFWSGVDKVVSDLTPKNQELLARRDELQAQIDKWHRSH
VLEPVDPVAYKQFLTDIGYLLPEPEDFTITTAGVDDEITTTAGPQLVVPILNARFALNAA
NARWGSLYDALYGTDVISEEDGAEKGTGYNKIRGDKVIAYARGFLDEVVPLAEGSWSEAT
GLKIDDGALEVALGDDKVTGLSVPEAFVGYTGELGEPQWSVLLRNHGLHIEILIDPSSPV
GSTDSAGIKDVVLESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDLTEEVTKGDKT
FTRVLNDDRVFKTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDADGNEIPEGIQDALFT
SLIAMHGLKAGDQNGPLTNSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPANTLK
VGIMDEERRTSVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQPW
ILAYEDANVDVGLAAGFSGKAQIGKGMWAMTDLMADMVEQKIGQPKAGATTAWVPSPTAA
TLHAMHYHQVDVFAVQSELAGKKRGKLEDLLTIPLADSSLTWSPEEIHEEVDNNCQSILG
YVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVKTSLRRMAA
VVDEQNAGDPAYLPMAPNPDASIAFAAAQELILSGTQQPNGYTEPILHRRRREFKARAAA
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggtgctgcacgacttcatcaccaacgaggcgctgccgggtactggcgtagac
cccgacagcttctggtcgggtgtcgacaaggtggtctccgacctgaccccgaagaaccag
gaactgctggcgcgccgcgacgaactgcaggcgcagatcgacaagtggcaccgctcgcac
gtgctcgagccggtggacccggtcgcctacaagcagttcctcaccgacatcggctacctg
ctgccggagcccgaggacttcaccatcaccaccgcaggtgtcgacgacgagatcaccacc
accgcgggcccgcagctcgtggtgccgatcctcaacgcgcgcttcgccctcaacgccgca
aacgcacgctggggttcgctgtacgacgcgctgtacggcaccgacgtcatctccgaggag
gacggcgccgagaagggcacggggtacaacaagatccgtggcgacaaggtgatcgcctac
gcgcgcggattcctcgacgaggtcgtgccgctggccgagggttcgtggagcgaggccacc
ggtctgaaaatcgacgacggcgcactggaagtcgcgctcggcgacgacaaggtcaccgga
ctctcggtgcccgaggcgttcgtcggctacaccggcgaactcggcgagccgcagtggtcg
gtgctgctgcgcaatcacgggctgcacatcgagatcctcatcgacccgtcctcgcccgtc
ggctcgaccgactccgcaggcatcaaggacgtcgtgctggagtccgcggtcaccacgatc
atggacttcgaggattcggtcgccgcggtcgacgccgacgacaaggtgctcggctaccgc
aactggctgggcctgaaccgcggtgacctcaccgaagaggtcaccaagggcgacaagacc
ttcacgcgtgtcctcaacgacgaccgcgtgttcaagacccccgacggcgaaggtgagctg
accctgcccggtcgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaacgac
gcgatcgtcgacgccgatgggaacgagatccccgaaggcatccaggacgcgttgttcacc
agcctgatcgcgatgcacggcctcaaggccggcgaccagaacggcccgctgaccaacagc
cgcacgggttcgatctacatcgtcaaacccaagatgcacggccccgacgaggtcgccttc
acctgtgagctgttcagccgcgtcgaggacgtgctcggcctgcccgccaacaccctcaag
gtcggcatcatggatgaggagcggcgcacctcggtcaacctcaaggcctgcatcaaggcc
gccgccgaccgcgtggtgttcatcaacaccggattcctcgaccgcaccggcgacgagatc
cacacctcgatggaagccgggcccatggtgcgcaagggcaccatgaagagccagccctgg
atcctggcctacgaggacgccaacgtcgacgtcggtctggccgccgggttctccggcaag
gcccagatcggcaagggcatgtgggccatgaccgacctgatggccgacatggtcgagcag
aagatcggccagcccaaggccggcgccaccaccgcgtgggtgccctccccgactgccgcc
acgctgcacgcgatgcactaccaccaggtcgacgtgttcgcggtgcagtccgaactcgcg
ggcaagaagcgcggcaagctcgaagacctgctgaccatcccgctggccgactcgtcgctg
acgtggtcgcccgaggagatccacgaagaggtcgacaacaactgccagtcgatcctgggc
tacgtggtgcgctggatcgacgccggtgtcggctgttcgaaggtccccgacatccacgac
gtcgcactcatggaggaccgcgcgacgctgcggatctccagccagctgctggccaactgg
ctgcgccacggtgtgatcaccgaggaggacgtcaagaccagcctgcggcgcatggcggcc
gtggtcgacgagcagaacgcgggcgatccggcgtacctgccgatggcgccgaaccccgac
gccagcatcgccttcgccgccgcgcaggagctgatcctgtcgggcacacagcaacccaac
ggctacaccgaaccgatcctgcaccggcgccgccgcgagttcaaagcccgcgccgctgcg
cagtga

DBGET integrated database retrieval system