KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3673Help
Entry
MSMEG_3673        CDS       T00434                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSMEG_3673 (malQ)
Enzymes [BR:msm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MSMEG_3673 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3738781..3740985
Genome map
AA seq 734 aa AA seqDB search
MTTTSDTSGAPGPGSASPVLAELASRYGVAVDYEDWAGRRIAVPESTLVAVLDALGVDAG
TEDSRVAALAAHDREYWQRPLPPIVLGRSGATSTFWVHVTHGDAVEVFLTLEDGTTRTGL
RQVENNRPPFDLGDRLVGEASFELPADLPLGYHRLHVRVDGARGFEAETPVVLSPARLAL
PTRLGARRAWGMAVQLYSVRSRNSWGTGDLTDLTDLAVWSAARHGAGFVLINPLHAASPA
PPMEPSPYLPTSRRFVNPLYLRVEAIPEYAEVRGRGRIRKTRTTVNQRAVRNGRIDRDAA
WKAKRAVLQQVYRVPRSAGRNIAYAAYRAREGRSLDDFATWCALAERYGSDWHTWPAELQ
HPRREEVAAFAAAHHDAVDFHRWLQWQLDDQLTAAQATATQAGMELGIMSDLAVGVDPDG
ADAWSLQEVLALGVSAGAPPDEFNQLGQDWSQPPWRPDKLVEHAYEPFRAVVNTALRHSG
GVRIDHIIGMFRLWWIPKGAAPTDGTYVRYDHEAMIGIIALEAHRSGAVVVGEDLGTVEP
WVRDYLHDRGLFGTSILWFESDEGRGPLPAERWREYCLSSVTTHDLPPTAGYLAGEHVRL
REELDLLTRPAAEELAEDRAAQAAWLDELRRVGLLGPDPSPDTETVVLALHRYLGRTPSK
LLALSLTDAVGDLKTQNQPGTTDEYPNWRVPLSGPDGRPLLLEEVFDDVRAARLADAMAG
ITRGATRGGTEGQL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacatcggacacatctggcgcccccggacccggttcggcctcgccggttctc
gccgaactcgcctcccggtacggcgtggccgtcgactacgaggactgggccggccgccgt
atcgcggtgccggaatccaccctggtggcggtgctcgacgcgctcggcgtcgacgcgggc
accgaggacagccgcgtggcggcgctggccgcacatgatcgcgagtactggcagcgaccg
ctgccgccgatcgtgctgggccggtccggcgccacgtccacattctgggtgcacgtgacc
cacggcgacgcggtcgaggtgttcctgacccttgaggacggcaccacgcgcaccgggttg
cggcaggtggagaacaaccgcccgcccttcgacctcggggatcgactggtcggcgaggcc
tccttcgagcttcccgccgatctgccgctgggctaccaccgtctgcacgtacgcgtcgac
ggggcacggggcttcgaagccgagaccccggtggtcctctcccccgccaggttggcgctg
cccacccggctgggagcgcggcgcgcttggggcatggccgtgcagctctacagcgtccgc
tccaggaactcttggggcacaggagatctgaccgacctgaccgatctggccgtgtggtcg
gcagcgcggcacggcgcgggcttcgtgctcatcaacccgctgcacgcggcgtcgcctgcc
ccgcccatggagccgtccccgtacctgccgacctcacggcgcttcgtcaacccgctgtat
ctgcgcgtcgaggcgatccccgagtacgccgaggtgcgcggccgtggccggatccgcaag
acccgaaccacggtcaaccagcgcgcggtccgcaacgggcgcatcgaccgcgacgccgct
tggaaggccaaacgcgctgtcctgcaacaggtgtaccgtgtgccgcgatcagccgggcgc
aacatcgcgtatgcggcctaccgggcccgcgagggccgcagtctcgacgatttcgcgacc
tggtgcgccctggccgaacgctacggcagcgattggcacacctggccggccgaactgcag
catccgcgccgcgaggaggtggcggcatttgcggcagcgcaccacgacgccgtcgacttc
catcgctggctgcagtggcaactcgacgaccagctgacggccgcgcaggccaccgccaca
caggcgggcatggagctcggcatcatgagcgaccttgcggtcggggtcgatccggacggc
gccgacgcgtggtcgctgcaggaggtactcgcgctcggggtcagcgcaggtgcgccgccc
gacgagttcaaccagttgggtcaggactggtcacagccgccgtggcggcccgacaaactc
gtcgagcacgcatacgagccgttccgcgccgtggtcaacaccgcgctgcggcactccggc
ggcgtgcgcatcgaccacatcatcggcatgttccggttgtggtggattcccaagggcgcg
gcaccgaccgacggcacctacgtgcgctacgaccacgaggcgatgatcggcatcatcgcc
ctcgaagcacaccggtccggcgcggtggtggtcggcgaggacctcggcacggtcgaaccg
tgggtgcgtgactacctgcacgaccgcggcctgttcggcacgtcgatcctgtggttcgaa
tcggacgagggccggggccccctgcccgccgagcgctggcgcgagtactgcctgtcgtcg
gtgacgacgcacgatctgccgcccaccgcgggttacctggccggtgagcacgtgcgccta
cgcgaggaactcgatctgctcacccggcctgccgcggaggaactggccgaggatcgcgcc
gcgcaggccgcgtggctcgacgagttgcggcgcgtcgggctgctcggtccggatccgtca
cccgacaccgagaccgtggtgctggccctgcaccgctacctgggccgcacgccgtcgaag
ctgctggcgttgtcgctgaccgacgcggtcggcgatctgaagacgcagaatcagccgggc
accaccgacgagtaccccaactggcgcgtaccgctgtccggtcccgacggccgtccgctg
cttctggaggaggtgttcgacgacgtccgcgccgcgcgtctcgcggatgcgatggcgggc
atcacgcgaggcgccacgagaggcgggacggaaggacagctgtaa

DBGET integrated database retrieval system