KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3706Help
Entry
MSMEG_3706        CDS       T00434                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_3706 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEG_3706 (aceA)
Enzymes [BR:msm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MSMEG_3706 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3770113..3772422
Genome map
AA seq 769 aa AA seqDB search
MATIEANAHNLSSSAKDFDSEVAATQAYFDSPRFEGITRLYSARQVVEQRGTIATDHTVA
REAAEAFHPYLRELFAQKKSITTFGPYSPGQAVVMKRMGIGGIYLGGWATSAKGSISEDP
GPDLASYPLSQVPDEAAGLVRALLTADRNQHYLRLQMTPEQREAQPPVDYRPFIIADADT
GHGGDPHVRNLIRRFVESGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGVTNLKIPSYKSCFLAMMRRFYDQGL
TEINGHLLYDLPEGQYEAAEAWLTGAGIMDEIAAAVESWTSGAASSVDALYDAVESKFVD
AWQDDAGLNTYGEAVAEVIEFREREGESVAMSAAEWREFATRAPLYTATNKARELGVDVA
WDCEPAKTPEGYYQVRGGIPYAIAKSLAAAPFADILWMETKTADLADAKQFADAIHAVYP
DQMLAYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVACEEFATSL
RQEGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPKKLLEEWLAMWSEHYGLPEKLHVQLRPRRAGSDVLDLQILGEGGDGTDPLANV
VVDPIKDRHGRSILTVRDQNTFAEQMRKKRLMDLIHLWLIHRFKAEIVYYVTPTEDNIYQ
TEKMKAHGIFSDVYQEVGEIIVADVNKPRIEELLASDREALGRLIRKED
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatcgaagccaacgcacacaacctgtcgtcatcggcaaaggacttcgacagt
gaggtggctgccacgcaggcctacttcgacagtccacggttcgagggcatcacccggctg
tactcggcccgtcaggtcgtcgagcaacgcggcacgatcgccaccgaccacaccgtggcc
cgtgaggccgcggaggcgttccacccctacctgcgcgagttgttcgcccagaagaagagc
atcacgacgttcggcccgtactccccgggacaggccgtggtgatgaaacgcatgggtatc
ggcggcatctacctcggtgggtgggcgacctcggcgaagggctcgatcagtgaggatccg
ggtccggacctcgcgagctacccgctgagtcaggttcccgacgaggccgcaggcctggtg
cgggcgctgctcaccgccgaccgcaaccagcactacctgcgcctgcagatgacgcccgaa
cagcgcgaggcccagccgcccgtcgactaccggcccttcatcatcgccgacgccgacacc
ggccacggcggagatccgcacgtacgcaacctgatccgtcgcttcgttgaatccggagtg
cccggctaccacatcgaggaccagcggcccggcaccaagaagtgcggccatcagggcggc
aaggtgctcgtgccgtcggacgagcagatcaaacggctcaacaccgcacgcttccagctc
gacatcatgcgggtgccgggaatcatcgtggcgcgcaccgacgccgaggccgcgaacctg
atcgacagccgcgccgacgagcgggatcagccgttcctgctcggcgtcaccaacctcaag
atcccgtcgtacaagtcgtgtttcctggcgatgatgcggcggttctacgaccagggcctg
accgagatcaacggtcacctgctctacgacctgcccgaaggccagtacgaagctgccgag
gcgtggctgaccggcgcgggcatcatggacgagatcgccgcggcggtcgagtcgtggacg
tccggcgccgcatcctcggtcgacgccctgtacgacgcggtcgagtcgaagttcgtcgac
gcctggcaggacgacgcgggcctcaacacctacggcgaggcggtcgccgaggtcatcgag
ttccgtgaacgtgagggtgaatccgtcgcgatgagcgccgccgagtggcgcgagttcgcc
accagagcgccgttgtacacggccaccaacaaggcgagagaactcggcgtcgacgtcgcg
tgggactgcgaaccggccaagaccccggaaggctactaccaggtgcgcggcggaattccg
tacgccatcgccaaatcgctggccgccgcgccgttcgcggacatcctgtggatggagacc
aagaccgccgatctggccgacgccaagcagttcgccgacgcgatccacgccgtgtacccc
gatcagatgctggcctacaacctgtcgccgtcgttcaactgggacaccacgggcatgacc
gacgacgagatgcgggcgttccccgaggaactcggcaagatggggttcgtcttcaacttc
atcacctacggcggtcaccaggtggacggcgtggcgtgcgaggagttcgcgacctcactg
cgccaggagggcatgctggcgctggcccggctgcagcgcaagatgcgcctggtcgaatcc
ccctatcgcacaccgcaaacgctcgtcggcgggccacgcagcgacgcggccctggcggcg
tcctccggacggacagcgaccaccaaggccatgggcaagggctccacgcagcaccagcac
ctggtgcaaaccgaggtgcccaagaagctgctcgaggaatggctcgcgatgtggagcgag
cactacgggttgcccgaaaaactccacgtgcaactgcgcccgcggcgcgcgggttccgac
gtgctggacctgcagatcctgggcgagggcggcgacggcacagacccgctggccaacgtg
gtcgtcgaccccatcaaggatcgccacggccgcagcatcctcacggtgcgtgaccagaac
acgttcgccgagcagatgcgcaagaaacgcctgatggacctgatccacctgtggctgatc
caccgtttcaaggccgagatcgtgtactacgtgacgccaaccgaggacaacatctaccag
accgagaagatgaaagcgcacggcatcttcagcgatgtctaccaggaggtcggcgagatc
atcgtggccgacgtcaacaagccccgtatcgaggagctgctggcctccgaccgtgaggca
ctgggccggctgatccgcaaggaggactga

DBGET integrated database retrieval system