KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3739Help
Entry
MSMEG_3739        CDS       T00434                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  
CMP/dCMP kinase [EC:2.7.4.25]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MSMEG_3739 (cmk)
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     MSMEG_3739 (cmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3804186..3804872)
Genome map
AA seq 228 aa AA seqDB search
MSGSLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIE
KAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLA
TEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQR
RDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLVTAQAGARR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggaagtttggttgttgcggtggacggcccggccggcaccggaaagtcctcggtg
tcacgggggttggcccgcgcgctcggcgcccggtacctcgacaccggcgcgatgtaccgc
atcgcgacgcttgcggtgctgcgggccggtgctgacctcaccgaccctgcggcgatcgag
aaggccgccgccgacgccgagatcggagtgggctcagatcccgatgtcgacgcggcattc
cttgccggagaagatgtttcgtcggagatccgcggtgacgcggtgaccggcgcggtgtcg
gcggtctccgcagttcccgccgtgcgcacacgcctggtcgacattcagcgcaagctggcc
accgagggtgggcgagtggtggtcgagggccgcgacatcggcaccgtcgtgctgcccgat
gccgacgtcaagatcttcctcaccgcgtcggccgaggaacgcgcgcggcgacgcaacgcg
cagaacgtcgccaacggactgcccgacgactacgcaactgtgctggccgacgtacagcgt
cgcgaccatctcgactcgacccgtcccgtgtcgccgctgcgcgccgccgacgacgcgctg
gtggtcgacacgagcgacatggaccaggcccaggtgatcgcccacctgctcgatctggtc
accgcacaggcgggagcacgtcgatga

DBGET integrated database retrieval system