KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3947Help
Entry
MSMEG_3947        CDS       T00434                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_3947
   01230 Biosynthesis of amino acids
    MSMEG_3947
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_3947
   00030 Pentose phosphate pathway
    MSMEG_3947
   00051 Fructose and mannose metabolism
    MSMEG_3947
   00052 Galactose metabolism
    MSMEG_3947
  Energy metabolism
   00680 Methane metabolism
    MSMEG_3947
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSMEG_3947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4017452..4018450)
Genome map
AA seq 332 aa AA seqDB search
MRSAAFAVGKRRMDTGRPNIVTLTMNPALDITTCADQVRHTDKIRCGATRYDPGGGGINV
ARVAHVLDGPVVAVFTSGGPTGAMVADLVRREGVAYEPVEISGVTRESFTVNEGCTGKQY
RFVLPGPHLTMTEQAQCVENLRRHAMSAEFVVASGSLPPGVDPRFYQQIADMCRESGVPL
ILDTSGGGLSHIESGVFVLKPSLRELRECTGKELTTEREQVAAARDLIDRGVTDVVIVSL
GGDGALMVTARQSQRFKAVPVASGSGVGAGDAMVAAITVGLSRGWPLPKSVRYGIAAGAA
MLLTPGTAVCRRAEVERLFALAAEPEDLTSGW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgcagcgttcgcggtcggcaagcgccggatggataccggcagaccgaacatc
gtgacgttgacgatgaatccggcgctggacatcacgacctgtgccgaccaggttcggcac
acggacaagatccgttgtggcgcaacccggtacgatccaggcggcggcggcataaacgtg
gctcgcgtcgcgcacgtcctggacggaccggtagttgccgtgttcacatctggcggccct
accggtgcgatggtggccgacctggtgcggcgggaaggtgtggcgtacgaacctgtcgag
atctcgggggtgacgcgtgagagcttcaccgtgaacgagggttgtacgggcaagcagtac
cgtttcgtgctgccgggcccgcacctgaccatgaccgaacaggcgcagtgcgtggaaaac
ctgcgccgccacgccatgtcggcggagttcgtggtggccagtggcagcctgccaccaggt
gtggatccccggttctatcagcagattgccgacatgtgtcgtgaatccggggtaccgctc
atcctcgacacctcgggtgggggactgtcacacatcgaatcgggggtgttcgtactgaag
cccagtttgcgggagttgcgcgaatgcacaggcaaggaactgaccaccgagcgtgagcag
gtcgccgcggcgagggacctcatcgatcgtggtgtgacagacgtggtcatcgtgtcgttg
gggggcgacggagccctcatggtgaccgcgcgtcagagccagcggttcaaggccgtgccg
gtggcatctggcagcggggtcggagcaggggatgcgatggtcgcggccatcacggtcggc
ctgagccgtgggtggccgctgcccaagtcggtgcgttacggcatcgcggccggcgcggcg
atgctgctgaccccgggcaccgcggtgtgccgacgcgccgaggtcgagcggttgttcgcg
ttggcggccgagcccgaggatctcacctcggggtggtga

DBGET integrated database retrieval system