KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3947Help
Entry
MSMEG_3947        CDS       T00434                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00030  Pentose phosphate pathway
msm00051  Fructose and mannose metabolism
msm00052  Galactose metabolism
msm00680  Methane metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
msm01230  Biosynthesis of amino acids
Module
msm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_3947
   00030 Pentose phosphate pathway
    MSMEG_3947
   00051 Fructose and mannose metabolism
    MSMEG_3947
   00052 Galactose metabolism
    MSMEG_3947
  Energy metabolism
   00680 Methane metabolism
    MSMEG_3947
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSMEG_3947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin NAD_kinase
Motif
Other DBs
NCBI-GeneID: 4534449
NCBI-ProteinID: YP_888237
UniProt: A0QZ99
Position
complement(4017452..4018450)
Genome map
AA seq 332 aa AA seqDB search
MRSAAFAVGKRRMDTGRPNIVTLTMNPALDITTCADQVRHTDKIRCGATRYDPGGGGINV
ARVAHVLDGPVVAVFTSGGPTGAMVADLVRREGVAYEPVEISGVTRESFTVNEGCTGKQY
RFVLPGPHLTMTEQAQCVENLRRHAMSAEFVVASGSLPPGVDPRFYQQIADMCRESGVPL
ILDTSGGGLSHIESGVFVLKPSLRELRECTGKELTTEREQVAAARDLIDRGVTDVVIVSL
GGDGALMVTARQSQRFKAVPVASGSGVGAGDAMVAAITVGLSRGWPLPKSVRYGIAAGAA
MLLTPGTAVCRRAEVERLFALAAEPEDLTSGW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgcagcgttcgcggtcggcaagcgccggatggataccggcagaccgaacatc
gtgacgttgacgatgaatccggcgctggacatcacgacctgtgccgaccaggttcggcac
acggacaagatccgttgtggcgcaacccggtacgatccaggcggcggcggcataaacgtg
gctcgcgtcgcgcacgtcctggacggaccggtagttgccgtgttcacatctggcggccct
accggtgcgatggtggccgacctggtgcggcgggaaggtgtggcgtacgaacctgtcgag
atctcgggggtgacgcgtgagagcttcaccgtgaacgagggttgtacgggcaagcagtac
cgtttcgtgctgccgggcccgcacctgaccatgaccgaacaggcgcagtgcgtggaaaac
ctgcgccgccacgccatgtcggcggagttcgtggtggccagtggcagcctgccaccaggt
gtggatccccggttctatcagcagattgccgacatgtgtcgtgaatccggggtaccgctc
atcctcgacacctcgggtgggggactgtcacacatcgaatcgggggtgttcgtactgaag
cccagtttgcgggagttgcgcgaatgcacaggcaaggaactgaccaccgagcgtgagcag
gtcgccgcggcgagggacctcatcgatcgtggtgtgacagacgtggtcatcgtgtcgttg
gggggcgacggagccctcatggtgaccgcgcgtcagagccagcggttcaaggccgtgccg
gtggcatctggcagcggggtcggagcaggggatgcgatggtcgcggccatcacggtcggc
ctgagccgtgggtggccgctgcccaagtcggtgcgttacggcatcgcggccggcgcggcg
atgctgctgaccccgggcaccgcggtgtgccgacgcgccgaggtcgagcggttgttcgcg
ttggcggccgagcccgaggatctcacctcggggtggtga

DBGET integrated database retrieval system