KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3986Help
Entry
MSMEG_3986        CDS       T00434                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:msm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:msm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:msm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:msm00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:msm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4056401..4058032
Genome map
AA seq 543 aa AA seqDB search
MIPDPESRVYELLRQYDEPTACAATLICDRHPDDDVAFTVVEPDLSAADLTYGQLREQST
KFAAALSELGIGPGDHVATLMGKSAELVVALLGIWRRGAIHVPLFTAFAPPAITHRLRAS
DARLVICDADQLHKITHDDSAPSPAPWRVVVAGPSTTDDVLELAGLIRRHDGVSTAEMTA
VTGGSGTLVELFTSGTTGSPKGVAVPLRALASFHAYQEFGLDVRREDVFWNAADPGWAYG
LYYAILSPLATGTRSILLHAGFSPPLVWRVMERFGVTNFTAAPTVYRSLLTDPTSVPPTV
RLRRASSAGEPLTPDVISWSRANLGVLVRDHYGQTEHGMFIANAWADGLRDEVHEGSMGA
VLPGWRCNVLDLNTVTAAPSRRMGRVAIDAHNSPLMWFNGYTNAPDKTAERFTPDGHWYL
TGDIGHVDDEGKFHFCGRDDDVIIMAGYRIGPFDVESVLVMHPSVIEAAVVARPDHLRGE
VLEAFVVLREGTEGSEDLEKELQTLVKKKYAAHAYPRTVHFVTELPKTSSGKVQRHLLRR
GML
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgatccccgatccagagtcacgcgtatacgagctgctgcgtcagtacgacgaaccgacc
gcgtgcgcagcaaccctcatatgtgatcggcatcccgatgatgatgtcgcattcaccgtt
gtcgaacctgatttgtcagcagccgatctcacgtacggtcaactacgagaacagtccaca
aagttcgcagcggcactgtcggaactcggcatcgggccaggcgaccacgtcgcaacgttg
atgggtaagtcggccgagctcgtggtggcgctcctcggtatctggcgtcgcggtgcgatc
cacgtcccgttgttcactgccttcgccccgcctgcaatcacccataggcttcgcgccagc
gatgccaggctggtgatctgcgacgccgaccagctccacaagatcacacacgacgacagc
gcgccctcgcctgcgccgtggcgcgtcgtggttgcgggaccgtccaccaccgacgacgtc
ctagaactggccgggctcatcaggaggcacgacggggtgagcactgcagagatgaccgcc
gtcaccggcggatccgggacgttggtggaactgttcaccagcggaaccaccggatctccg
aaaggggttgcggtcccactgcgagcgctcgcgtcgttccacgcataccaggagttcggc
ctcgacgtccgccgagaggacgtcttctggaacgccgccgacccaggatgggcctacggg
ctttactacgcgattctcagcccactcgccaccggaacccgcagcatcctgctccacgcc
ggattctcaccgcctctggtatggcgggtgatggaacgctttggggtcaccaacttcacc
gcggcacccaccgtctatcggagcctgctgaccgatccaacctcggtcccaccgacggta
cggctgcggcgagcctcgtcggcaggtgaaccgctgacccctgatgtcatctcatggtcg
cgtgccaatctcggcgtccttgtccgagatcactacgggcagacagaacatgggatgttc
attgcgaacgcctgggccgacggcctccgagacgaggtgcacgaagggtcgatgggtgcc
gtactgccgggctggcgatgcaacgtgctcgatctcaacacggtgaccgcagcgccatca
cgaaggatgggtcgagttgcaatcgacgcccacaacagcccgctgatgtggttcaacggc
tacacgaacgccccagacaagactgcggagcgcttcacgccggatgggcattggtatctg
accggagacatcgggcatgtcgacgatgaaggaaaattccacttctgcggtcgcgacgac
gatgtgatcatcatggccggctaccggatcgggccattcgatgtggagagcgttctcgtc
atgcatccaagtgtcatcgaggctgcggttgtcgcccgacccgatcaccttcgcggcgag
gtgctcgaagcctttgtcgtgctccgcgagggcaccgagggatccgaagacctcgaaaag
gagctgcagaccttggtgaagaagaagtacgcggcccacgcctatccccgcaccgtccat
ttcgtcacagagctaccgaagacctccagcggcaaggtccaacgccacctcctccgccga
ggcatgttgtga

DBGET integrated database retrieval system