KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4149Help
Entry
MSMEG_4149        CDS       T00434                                 

Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00360  Phenylalanine metabolism
msm00362  Benzoate degradation
msm00620  Pyruvate metabolism
msm00621  Dioxin degradation
msm00622  Xylene degradation
msm00650  Butanoate metabolism
msm01100  Metabolic pathways
msm01120  Microbial metabolism in diverse environments
msm01220  Degradation of aromatic compounds
Module
msm_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEG_4149
   00650 Butanoate metabolism
    MSMEG_4149
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEG_4149
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_4149
   00622 Xylene degradation
    MSMEG_4149
   00621 Dioxin degradation
    MSMEG_4149
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEG_4149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored CoA_binding DapB_N NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 4533316
NCBI-ProteinID: YP_888429
UniProt: A0QZU1
Position
4229192..4230127
Genome map
AA seq 311 aa AA seqDB search
MDKVKVAIIGSGNIGTDLMMKTLRSSSLEMAVLVGVDPRSDGLARAERLGIATTSGGLDH
FVTTPEFEDVAIVFDATSAAAHERHASILAQLNKQVVDLTPAAVGPYVIPTVNMDRVVGE
PNVNMVTCGGQATVPIVAAISGVTPVHYAEIVASIASRSAGPGTRANIDEFTETTALALE
SVGGATQGKAIIVLNPAEPPLIMRDTVLCLCDEADETEIEAAVERMVASVAEFVPGYRLK
QKVQFQRYTRNSPLRLPEQEADFTGLQVSVFLEVEGAAHYLPAYAGNLDIMTSAALRTAE
RMTELDAIRGK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtgaaggtcgcgatcatcggatccggcaacatcggtaccgacctgatgatg
aagaccctgcgttcttcttcgctcgagatggcggtgctcgtgggggtcgatccgcggtcg
gatggcctggccagggcggagcgactcggaatcgccaccacctccggcggcttggatcat
ttcgtcacgacgcccgaattcgaggatgtggcgatcgtcttcgacgcaacctccgccgcc
gcacacgagcggcacgcatccatcctggcccagctgaacaagcaggtggtcgatctcacg
cctgccgctgtggggccatatgtgattccgacggtcaatatggaccgcgtcgtaggagag
cccaacgtgaacatggtgacctgtggtgggcaggcgaccgtgccgatcgtcgccgcgatt
tccggtgtgacccccgtgcactacgccgagatcgtcgcgtcgatcgcctcgcggtcggcg
ggccccggcaccagggcgaacatcgacgagttcaccgagacaaccgcactggcgctggag
agtgtcggcggcgccactcaaggaaaggcgatcatcgtactgaatccggcggaaccaccc
cttatcatgcgcgacacggtgctctgcctctgtgacgaggcagacgagacggaaatcgag
gccgcggtcgagcggatggtcgcttcggtcgcagagttcgtccctggctaccggctcaag
cagaaggtgcagttccagcggtacacccggaattccccactccgactaccagagcaagag
gctgacttcaccgggctccaggtttcggttttcctcgaggtagaaggggctgcccattac
cttcccgcctacgcgggaaatctcgacatcatgacctccgcagcattgcggaccgcggaa
cgtatgaccgaacttgacgcgattcgggggaagtga

DBGET integrated database retrieval system