KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4269Help
Entry
MSMEG_4269        CDS       T00434                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:msm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4352394..4354370
Genome map
AA seq 658 aa AA seqDB search
MCGLLALVTDPSRADQVEASPGTGSQLVSAVAEAAHLMRHRGPDEPGTWPDPDAENPHPE
VVLGFNRLSIIDIAHSHQPLRWGPADAPGRYLLVFNGEIYNYLELREQLRNEFGAQFHTD
GDSEAIVAAYHHWGVDALHRLRGMFAFAIWDTEKRELFCARDPFGIKPLFMATGPGGTAV
GSEKKCLLSLADRLGLDLGIDQRAVQHYTVLQYVPEPETLHRGVRRLESGSYARIRPGAA
PEVTRYFVPKFTAVNFAAGSEQARYDEITAALEDSVAKHMRADVTVGAFLSGGIDSTAIA
ALAMRHNPRLITFTTGFEREGFSEIDVAVASAEAIGARHVAKVVSQAEFVEALPEIVWYL
DEPVADPALVPLFFIAREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPRPLRK
SLGKASKPLPEGMRGKSLLHRGSLTLEERYYGNARSFSDDQLRAVLPQFRQEWTHTDVTA
PVYAASQGWDPVARMQHIDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFAVASRLP
VDQKITRATTKYALRRALEPIVPAHVLNRAKLGFPVPIRHWLRSGELMDWAYALIGSSGA
GEHVDLAAVRTMLDEHRNGVSDHSRRLWTVLIFMLWHAIFVEHSVTPQIKEPHYPVQL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgcttgccctggtgaccgacccgtcccgagccgaccaggtcgaggcgtcc
cccggaaccggatctcagctggtcagcgcggtcgccgaagcggcccatctgatgcgccac
cgcgggcctgacgagccgggaacctggcccgacccggacgccgagaacccccacccggag
gtggtcctcgggttcaaccggctgtcgatcatcgacatcgcccacagccaccagccgctg
cgctgggggccggccgacgccccgggacgctaccttctggtcttcaacggcgagatctac
aactacctggaactgcgcgagcagctgcgcaacgagttcggtgcgcaatttcacaccgac
ggtgacagcgaggccatcgtcgcggcctaccaccactggggtgtcgacgcgctgcaccgg
ctgcgcggcatgttcgcgttcgcgatctgggacaccgagaagcgcgagctgttctgtgcg
cgtgacccgttcggcatcaagccgctgttcatggcgacggggccgggcggcaccgcggtg
ggcagtgagaagaagtgcctgctgtccctggccgaccgcctgggcctggatctcggtatc
gaccagcgggccgtgcagcactacacggtgctgcagtacgtgcccgagcccgagacgctg
caccgcggcgtccgcaggctcgaatcgggcagctacgcgcgaatccgcccgggcgccgca
cccgaggtgacgcggtacttcgtcccgaagttcacggcggtgaacttcgccgcgggcagc
gagcaggcccgctacgacgagatcaccgcggcgctggaggattcggtcgccaagcacatg
cgcgccgacgtgaccgtcggggcgttcttgtccgggggcatcgattcgacggcgatcgcg
gcgctggcgatgcggcacaacccccgtctgatcacgttcaccacgggcttcgagcgcgag
gggttctcggagatcgacgtggccgtcgcgtcggccgaggcgatcggcgcgcgccatgtc
gcgaaggtggtcagccaggccgagttcgtcgaggcgctgccggagatcgtctggtatctc
gacgagccggtggccgaccccgcgctggtgccgctgttcttcatcgcgcgcgaggcccgc
aagcacgtcaaggtggtgctctcgggtgagggcgccgacgagttgttcggcggttacacc
atctaccgcgaaccgctgtcgctgcgaccgttcgactatctcccccgcccgctgcgcaag
tcgctgggcaaggcgtccaagccgctgccggagggcatgcgcggcaagagcctgctgcac
cgcggttcgctgacgctcgaagagcgctactacggcaacgcgcgcagcttctccgacgac
cagttgcgcgccgtgttgccgcaattccgccaggagtggacgcacaccgacgtgaccgcg
ccggtgtacgcggcgtcgcagggctgggatccggtggcgcgcatgcagcacatcgacctg
ttcacgtggctgcgcggcgacatcctggtcaaggccgacaagatgacgatggccaactcg
ctggagctgcgggtgccgttcctcgatcccgaggtgttcgcggtggcctcgcgtctgccg
gtcgatcagaagatcacgcgggcgacgaccaagtacgcgctgcgccgcgcgcttgagccg
atcgtgcccgcacacgtgctgaaccgcgccaagctgggattcccggtgccgatccggcac
tggctgcgctcaggtgagctcatggactgggcgtatgcgctgatcggctcgtcaggtgcc
ggtgagcatgtggacctggcggccgtgcgcacgatgctcgacgagcaccgcaacggcgtc
agcgatcacagccgcaggctgtggaccgtgctgatcttcatgctgtggcacgcgatcttc
gtcgagcacagcgtcacgccgcagatcaaggagccgcattaccccgtgcagctgtaa

DBGET integrated database retrieval system