KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4283Help
Entry
MSMEG_4283        CDS       T00434                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEG_4283 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEG_4283 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MSMEG_4283 (sucB)
Enzymes [BR:msm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MSMEG_4283 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4367210..4368967
Genome map
AA seq 585 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVELDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEIGGELAVIGEAGEASAEAPSEDSAPAPEPEPEPEPEPQQTQPTAAPAESVES
APAESSAPSQGGGSATPILMPELGESVTEGTVTRWLKNVGDKVEVDEPIVEVSTDKVDTE
IPSPVAGTLLSITANEDDVVEVGGELAKIGDAGAAAEPKPEPKPEPKAEPKPEPKPEPKP
EPKAEPKPEPKPEPKPEPKAEPAPAASSDGSPYVTPLVRKLAAENGIDLSTVKGTGVGGR
IRKQDVLAAAEKAKEAKQAPAASPAAAAPAAPAAASATPAPALAHLRGTTQKANRIRQIT
AKKTRESLQATAQLTQTHEVDMTKIVALRARAKAEFAEREGVNLTFLPFIARAVIDALKI
HPNVNASYNEDTKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLGGLARAIADIAARA
RSGNLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDEYGNES
IGVRSVCYLPLTYDHRLIDGADAGRFLTTIKRRLEEGAFEADLGL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgtccagatgcccgcactaggtgagagtgtcacagaggggacggtgacc
cgctggctcaagcaggagggcgacaccgtcgaactcgacgagccactgctcgaggtgtcc
accgacaaggtcgacaccgagatcccctccccggccgccggtgtgttgacgaagatcgtc
gcgcaggaggacgacaccgtggagatcggtggcgaactcgcggtgatcggcgaggccggc
gaggcatccgccgaggcaccctctgaagactccgccccggctcccgaacccgagcctgag
cccgaacccgagccccagcagacccagccgaccgcggccccggcggaatccgtcgagtcc
gcgcctgccgaatcgtcggccccgtcgcagggcggcgggtcggccaccccgatcctgatg
cccgagttgggcgagtcggtcaccgagggcaccgtgacccgctggctgaagaacgtcggc
gacaaggtcgaggtcgacgagccgatcgtcgaggtgtccaccgacaaggtcgacaccgag
atcccgtcaccggtggcgggcacgctgctgtcgatcaccgccaacgaggacgacgtcgtc
gaggtcggcggcgagctggcgaagatcggcgacgccggcgcggcggccgagccgaagccc
gagccgaaacccgagcccaaggccgagccgaagcccgaacccaagccggaacccaagccc
gagcccaaggccgaacccaagccggaaccgaagcccgaacccaagcctgagcccaaggcc
gagcccgcccccgcggcgagctccgacggttccccctatgtcactccgctggtgcggaag
ttggccgcggagaacgggatcgacctctccacggtcaagggcaccggtgtcggtggccgc
atccgcaagcaggacgtgctcgcggccgccgagaaggccaaggaggccaagcaggctccg
gcagcctcccccgccgcggcggcgcccgcggccccggctgccgcatcggccacgcctgcc
ccggcgctcgcacacctgcgcggcaccacgcagaaggcgaaccggatccgtcagatcacc
gcgaagaagacgcgtgagtcgctgcaggccaccgcgcagctgacgcagacccacgaggtc
gacatgaccaagatcgtggcgctgcgggcccgcgccaaggccgagttcgccgagcgcgaa
ggcgtcaacctcacgttcctgccgttcatcgcgcgtgcggtgatcgacgcgttgaagatc
caccccaacgtcaacgccagctacaacgaggacaccaaggagatcacctactacgacgcc
gagcacctcggcttcgcggtggacaccgaccagggtctgctgtcgccggtgatccacaac
gccggtgacctctcgctgggcggcctggcgcgcgcgatcgccgatatcgccgcccgcgcc
cggtcgggcaacctcaagcccgatgagctggccggtggcaccttcacgatcaccaacatc
ggcagccagggcgcgctgttcgacaccccgatcctggttccgccgcaggcggcgatgctg
ggcacgggtgccatcgtcaagcggccgcgcgtgatcgtcgacgagtacggcaacgagtcg
atcggtgtccggtcggtgtgctacctgccgctcacctacgaccaccgcctgatcgacggc
gccgacgccggacggttcctgaccacgatcaagcgcaggctcgaagagggcgcgttcgag
gccgacctgggtttgtga

DBGET integrated database retrieval system