KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4374Help
Entry
MSMEG_4374        CDS       T00434                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00330  Arginine and proline metabolism
msm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MSMEG_4374 (speB)
Enzymes [BR:msm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MSMEG_4374 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 4535424
NCBI-ProteinID: YP_888649
UniProt: A0R0G1 I7GC05
Position
complement(4460713..4461672)
Genome map
AA seq 319 aa AA seqDB search
MTNDKSRDAIVVPVDPQVQPRYAGWTTYARLPRLEDVSHADVAVVGVPFDSAVTYRPGAR
FGPNAIRQASRLVRGYNPELDIAPFQVCQFADAGDIACNPFDIGQAVDQVTAELTALLSK
GTRAVVLGGDHSVALPSLRAAHAVHGPVALVHFDAHLDTWDSYYGADLTHGSPFRRAFEE
GLLQETNMHVGVRGSIYDKQDLVEDAKFGFSVITCRDITKLGSDGVIERIRERVGDAPVY
VSVDIDVLDPAHAPGTGTPEAGGMSSRELLEVVRGLDQVNLIGADVVEVSPAYDHAEITA
VAAANVTWELLSVFGRKAR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgacaagagccgcgacgcgatcgtggtgccggtggatccgcaggtgcagccg
cggtacgccggctggacgacctacgcccgtctgccccggctggaggatgtctcccacgcc
gacgtggcggtggtgggcgtgccgttcgacagtgccgtcacctaccggcccggtgcgcgg
ttcggccccaacgcgattcgtcaggcgtcgcggctggtccgcggctacaaccccgaactc
gacatcgccccgttccaggtgtgccagttcgccgacgccggtgacatcgcgtgcaacccg
ttcgacatcggccaggccgtcgatcaggtgaccgcggaactgaccgcgctgctgtccaag
ggcacccgcgcggtggtcctcggtggcgaccactcggtggcgctgccgtcgttgcgcgcc
gcccacgccgtgcacggcccggtggccctggtgcacttcgacgcccacctcgacacctgg
gactcctactacggggccgacctcacccacggctcaccgttccgccgggccttcgaggag
ggcctgctgcaggagacgaacatgcacgtcggcgtgcgcggatccatctacgacaagcag
gatctggtcgaggacgccaagttcggcttctcggtgatcacctgccgcgacatcaccaag
ctcggttccgacggcgtgatcgagcgcatccgcgaacgtgtgggcgacgcaccggtgtac
gtgtcggtggacatcgacgtcctcgatcccgctcatgcccccggcacgggaacgcctgag
gccggcggcatgtcgagccgcgaactgctcgaagtggtgcgtggtctcgatcaggtgaac
ctgatcggcgccgacgtcgtcgaggtgtccccggcctacgaccacgccgagatcaccgcc
gtggccgcggccaacgtgacctgggaactgttgagtgtgttcggaaggaaggcccgctga

DBGET integrated database retrieval system