KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4579Help
Entry
MSMEG_4579        CDS       T00434                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
msm  Mycobacterium smegmatis MC2 155
Brite
Enzymes [BR:msm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     MSMEG_4579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4670951..4671631)
Genome map
AA seq 226 aa AA seqDB search
MRIRRLVMLRHGQTEYNAGSRMQGQLDTDLSDLGRDQAAAAAEVLAKRQPLLIVSSDLRR
ALDTAETLGTRAGVAVAVDKRLRETHLGDWQGLTHLEVDAAAPGARLAWRDDARWAPHGG
ESRVDVAERSLPLVVELVAQQSEWGLDRPGAGAERPVVLVAHGGLIAALTAELLGLPVDN
WPVLGGMGNASWVQLSGHSADDAEFADIRWRLDVWNASAQVANDVL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaggatccgtcggctggtgatgttgcgtcacggccagaccgagtacaacgcgggcagc
cggatgcagggccagctcgacaccgacctgtccgacctcggccgcgatcaggccgccgcg
gcggccgaggtgctggccaaacggcagccgctgctgatcgtctcgtcggatctgcggcgg
gcgctggacacggccgagaccctcggcacccgtgcgggcgtggcggtggcggtcgacaag
cgcctgcgcgagacgcatctgggggactggcaggggctgacccatctcgaggtcgacgcc
gcggccccgggtgcccggctggcctggcgcgacgacgcccggtgggcgccgcacggcggt
gagagccgcgtggacgtcgccgagcgcagcctgccgctggtcgtcgaactcgttgcgcaa
cagtccgaatggggcctggaccgcccgggggccggtgccgaacgccccgtggtgctggtg
gcccacggtgggctgatcgcggcactgaccgccgagctgctcggcctgccggtcgacaac
tggccggtgctgggcggcatgggtaacgccagctgggtgcagctgtccgggcattcggcc
gacgacgcggagttcgcggacatccgctggcgactcgacgtgtggaacgcctcggcgcag
gtggccaacgatgtcctctga

DBGET integrated database retrieval system