KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4710Help
Entry
MSMEG_4710        CDS       T00434                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00020  Citrate cycle (TCA cycle)
msm00620  Pyruvate metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
Module
msm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_4710
   00020 Citrate cycle (TCA cycle)
    MSMEG_4710
   00620 Pyruvate metabolism
    MSMEG_4710
Enzymes [BR:msm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MSMEG_4710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 4531744
NCBI-ProteinID: YP_888970
UniProt: A0R1D2 I7GDZ1
Position
complement(4800165..4801385)
Genome map
AA seq 406 aa AA seqDB search
MSTRDFLVPDLGEGLQDATITSWNVDVGDTVELNQTLCTVETNKAEVEIPSPYAGKVEAL
GGAAGDTLAVGSLLVRIATSSDEPVEAQPMNGEVPQRKSVLVGYGADDSMDASRRRTHGP
RARAKPPVRKLAAELNVDLGALDPGSGPDGIITRDDVLAAAGRSPAAQSAGTPQPSQTRD
VRGVQAEMARRMALSRREIPDAHARVDVDCTALLRLRDRIRSAETELPITPFVLTLRLLT
VALRRHVVLNATWMETTGGPQIHQHSAVHLGIGVAAPRGLLVPVVRDAQGMTTRQLAVTV
ARLVESARAGTLSPAELTGSTFTVSNFGALGVDDGVPVINYPEAAILGMGSLRERPVVVD
GAVVARPTMSLTCVFDHRIADGAQAAAFLGELRGLIEEPDLALLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacccgggacttcctggtgcccgatctcggtgagggcctccaggacgcgaccatc
accagctggaacgtcgacgtcggcgacaccgtcgagttgaaccagacgctgtgcacggtc
gagaccaacaaggccgaggtcgagatccccagcccgtatgcaggcaaggtggaagcgctc
ggcggcgcggcaggggacacccttgccgtggggtcgttgctggtgcgtatcgccacgtcc
tccgacgagccggtcgaggcgcagccgatgaacggtgaagttccacaacgcaagtcggtg
ctcgtggggtatggcgccgacgactcgatggatgccagccgccgccgcacgcacggtccg
cgagcgcgtgccaagccgcccgtgcgcaagctggccgcggaactcaacgtcgacctgggc
gcgttggacccgggatcgggtcccgacggcatcatcacacgcgacgacgtgctggccgcg
gcgggcagatccccggcagcgcagagcgccggcacccctcagccgtcgcagacccgcgac
gtgcgcggggtgcaggccgagatggcgcgacgaatggcgttgtcgcgccgcgagatcccc
gatgcacacgcacgcgtcgacgtcgactgcaccgcgctgctgcgattgcgtgaccgcatc
cgcagcgccgagaccgagctgcccatcacgccgttcgtgctgacgctgcgcctgctgacc
gtcgcgttgcgccgtcacgtggtactcaacgcgacctggatggagaccaccggcggcccg
cagatccatcaacactcggcggtgcacctggggatcggtgtcgccgcgccgcgcggtctg
ctggtgccagtggtgcgcgatgcgcagggcatgaccacgcggcaactcgcggtcacggtg
gcccggctcgtcgaaagcgcccgcgcgggcacgctgtcgcctgccgaactgacggggtcg
acgttcacggtgtcgaacttcggcgcgctcggcgtcgacgacggcgttccggtgatcaac
taccccgaggccgcgatcctcggcatgggctcgctgcgggagcggcccgtcgtggtcgac
ggagccgtcgtggcccgcccgacgatgtcgctcacctgcgtgttcgaccaccgcatcgcc
gacggggcccaggccgcggcgttcctcggcgaactacgcgggctgatcgaggaacccgac
ctggctctcctcgatctctga

DBGET integrated database retrieval system