KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4754Help
Entry
MSMEG_4754        CDS       T00434                                 

Definition
K+-dependent Na+/Ca+ exchanger-like protein
Orthology
K07301  
cation:H+ antiporter
Organism
msm  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4850171..4851178)
Genome map
AA seq 335 aa AA seqDB search
MLGSAAWFVAGLLALAFGSEVMVRGGAQMASRMGISPIVVGMTVVSIGTSLPELAVGVTA
ATEGSGALAVGNIAGTNTVNLLFILGLSALLRPLAIQRRTLRLDLPVMAVAAVLFWVLCI
DGTLSRVDGVILLCAAVAYTVVVVRSARVESRDVVDEYAYAYRGEPAGDDGAAEREPDMP
DTGSLVRYFAMTIVGITVVVVGADWLVEGAVGIAREFGVSDALIGLTIVAIGTSAPELVT
TIVSTVRGERDIAIGNLLGSSVYNIVLILGATCLVPADGLPLNSSLVWIDIPVMVVATLL
LIPVFFSGRRVHRAEGGAMVVAYLAYLTFLLFTQT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggcagcgctgcctggttcgtggcgggcctgctcgccctggcgttcgggtcagag
gtgatggttcgcggtggtgcccagatggcgtcgcgaatgggtatcagccccatcgtcgtc
ggtatgacggtggtgtctatcgggacgagtctgcccgaactggccgtgggcgtgacggcg
gccaccgagggtagcggtgcgctcgcggtcggcaacatcgcgggcaccaacaccgtgaac
ctgctgttcatcctcgggctcagtgcactgttgcggcccttggcgattcagcggcgcacg
ttgcgtctcgatctgcccgtgatggcagtggcagcggtgctgttctgggtgctgtgcatc
gacgggacgctgtcgcgcgtcgacggcgtgatcctgctgtgtgccgcggtcgcctacacc
gtggtggtggtgcgctcggcgcgggtcgagagccgggacgtcgtcgacgagtacgcgtac
gcgtaccgaggtgagccggcaggcgacgacggcgccgcagagcgtgaacccgacatgccc
gacacgggaagcctcgtacggtatttcgcgatgacgatcgtcggtatcaccgtcgtggtc
gtcggggccgattggctcgtcgagggggctgtgggtatcgcacgcgaattcggggtctcc
gacgcgctgatcgggctcacgatcgtcgcgatcggcacgtcggctcccgaactggtgacg
acgatcgtctccacggtgcgcggcgagcgcgacatcgcgatcggaaacctgttgggcagc
agcgtctacaacatcgtgctgatcctgggcgccacgtgcctggtgcctgcggacgggttg
ccgctcaactcgagcctggtgtggatcgacatccccgtcatggtcgtcgcgaccctgttg
ctgatcccggtcttcttctcggggcgccgcgtccatcgcgccgagggcggcgcgatggtg
gtggcctacctggcgtacctgaccttcctgctgttcacacagacctga

DBGET integrated database retrieval system